Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1336192..1336372 | Replicon | chromosome |
| Accession | NZ_CP024998 | ||
| Organism | Staphylococcus aureus strain 55-99-44 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CU118_RS14195 | Protein ID | WP_001801861.1 |
| Coordinates | 1336192..1336287 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1336315..1336372 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CU118_RS06590 | 1331593..1332219 | + | 627 | WP_054190584.1 | hypothetical protein | - |
| CU118_RS06595 | 1332260..1332601 | + | 342 | WP_054190585.1 | DUF3969 family protein | - |
| CU118_RS06600 | 1332702..1333274 | + | 573 | WP_054190586.1 | hypothetical protein | - |
| CU118_RS06605 | 1333651..1334487 | + | 837 | WP_054190587.1 | ABC transporter ATP-binding protein | - |
| CU118_RS06615 | 1335294..1335740 | - | 447 | WP_054190589.1 | DUF1433 domain-containing protein | - |
| CU118_RS14195 | 1336192..1336287 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1336315..1336372 | - | 58 | - | - | Antitoxin |
| CU118_RS06625 | 1336410..1336511 | + | 102 | WP_054190590.1 | hypothetical protein | - |
| CU118_RS06630 | 1336497..1336764 | - | 268 | Protein_1268 | transposase | - |
| CU118_RS14250 | 1336796..1337158 | + | 363 | WP_054190591.1 | hypothetical protein | - |
| CU118_RS06640 | 1337180..1337683 | + | 504 | WP_054190592.1 | hypothetical protein | - |
| CU118_RS06650 | 1338238..1338681 | - | 444 | WP_054190593.1 | DUF1433 domain-containing protein | - |
| CU118_RS06655 | 1338681..1339124 | - | 444 | WP_054190594.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T89431 WP_001801861.1 NZ_CP024998:1336192-1336287 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T89431 NZ_CP024998:1336192-1336287 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT89431 NZ_CP024998:c1336372-1336315 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|