Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 62399..62663 | Replicon | plasmid pCV839-15-p2 |
| Accession | NZ_CP024976 | ||
| Organism | Escherichia coli strain CV839-15 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | CV83915_RS01045 | Protein ID | WP_001303307.1 |
| Coordinates | 62511..62663 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 62399..62461 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CV83915_RS01030 | 58501..59571 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| CV83915_RS01035 | 59590..60798 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - | 60978..61038 | - | 61 | NuclAT_3 | - | - |
| - | 60978..61038 | - | 61 | NuclAT_3 | - | - |
| - | 60978..61038 | - | 61 | NuclAT_3 | - | - |
| - | 60978..61038 | - | 61 | NuclAT_3 | - | - |
| CV83915_RS01040 | 61105..62196 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
| - | 62399..62461 | - | 63 | NuclAT_2 | - | Antitoxin |
| - | 62399..62461 | - | 63 | NuclAT_2 | - | Antitoxin |
| - | 62399..62461 | - | 63 | NuclAT_2 | - | Antitoxin |
| - | 62399..62461 | - | 63 | NuclAT_2 | - | Antitoxin |
| CV83915_RS01045 | 62511..62663 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| CV83915_RS01050 | 62735..62986 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| - | 63373..63424 | - | 52 | NuclAT_4 | - | - |
| - | 63373..63424 | - | 52 | NuclAT_4 | - | - |
| - | 63373..63424 | - | 52 | NuclAT_4 | - | - |
| - | 63373..63424 | - | 52 | NuclAT_4 | - | - |
| CV83915_RS29305 | 63910..64086 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| CV83915_RS01065 | 64295..64504 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| CV83915_RS01070 | 64602..65216 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| CV83915_RS01075 | 65292..67460 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 | - | 1..195578 | 195578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T89379 WP_001303307.1 NZ_CP024976:62511-62663 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T89379 NZ_CP024976:62511-62663 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT89379 NZ_CP024976:c62461-62399 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|