Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 65430..65700 | Replicon | plasmid tig00000138_pilon |
Accession | NZ_CP024888 | ||
Organism | Escherichia coli strain AR_0019 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | AM346_RS00430 | Protein ID | WP_001312861.1 |
Coordinates | 65542..65700 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 65430..65493 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AM346_RS00405 | 61200..61727 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
AM346_RS00410 | 61785..62018 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
AM346_RS00415 | 62079..64043 | + | 1965 | WP_000117316.1 | ParB/RepB/Spo0J family partition protein | - |
AM346_RS00420 | 64112..64546 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
AM346_RS00425 | 64543..65262 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 65274..65498 | + | 225 | NuclAT_0 | - | - |
- | 65274..65498 | + | 225 | NuclAT_0 | - | - |
- | 65274..65498 | + | 225 | NuclAT_0 | - | - |
- | 65274..65498 | + | 225 | NuclAT_0 | - | - |
- | 65430..65493 | - | 64 | - | - | Antitoxin |
AM346_RS00430 | 65542..65700 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
AM346_RS00450 | 66616..66912 | + | 297 | WP_001272251.1 | hypothetical protein | - |
AM346_RS00455 | 67023..67844 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
AM346_RS00460 | 68141..68743 | - | 603 | Protein_77 | transglycosylase SLT domain-containing protein | - |
AM346_RS00465 | 69064..69447 | + | 384 | WP_001151538.1 | relaxosome protein TraM | - |
AM346_RS00470 | 69634..70323 | + | 690 | WP_016239105.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B | - | 1..76754 | 76754 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T89127 WP_001312861.1 NZ_CP024888:65542-65700 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T89127 NZ_CP024888:65542-65700 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT89127 NZ_CP024888:c65493-65430 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|