Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 130430..130669 | Replicon | plasmid unitig_1_pilon |
| Accession | NZ_CP024863 | ||
| Organism | Escherichia coli strain AR_0015 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | AM342_RS27235 | Protein ID | WP_023144756.1 |
| Coordinates | 130430..130564 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 130609..130669 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM342_RS27205 | 126131..126988 | - | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
| AM342_RS27210 | 126981..127055 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| AM342_RS28650 | 127052..127186 | - | 135 | Protein_152 | protein CopA/IncA | - |
| AM342_RS27220 | 127417..128958 | + | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
| AM342_RS27225 | 128973..129719 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| AM342_RS27230 | 129879..130133 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| AM342_RS27235 | 130430..130564 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 130609..130669 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 130609..130669 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 130609..130669 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 130609..130669 | + | 61 | NuclAT_2 | - | Antitoxin |
| AM342_RS28655 | 130636..130922 | - | 287 | Protein_157 | DUF2726 domain-containing protein | - |
| AM342_RS27250 | 131435..131647 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| AM342_RS27255 | 131778..132338 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| AM342_RS27260 | 132393..133139 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(B) / dfrA17 / aadA5 / qacE / sul1 / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / blaTEM-1B / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / aac(3)-IId | - | 1..139059 | 139059 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T88980 WP_023144756.1 NZ_CP024863:c130564-130430 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T88980 NZ_CP024863:c130564-130430 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT88980 NZ_CP024863:130609-130669 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|