Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 12497..12737 | Replicon | plasmid unitig_1_pilon |
| Accession | NZ_CP024863 | ||
| Organism | Escherichia coli strain AR_0015 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | AM342_RS26415 | Protein ID | WP_001312861.1 |
| Coordinates | 12497..12655 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 12699..12737 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM342_RS26370 | 7609..7836 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| AM342_RS26375 | 7924..8601 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| AM342_RS26380 | 8735..9118 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| AM342_RS26385 | 9449..10051 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| AM342_RS26390 | 10348..11169 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| AM342_RS26395 | 11288..11575 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| AM342_RS28645 | 11600..11806 | - | 207 | WP_024190427.1 | hypothetical protein | - |
| AM342_RS26415 | 12497..12655 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 12699..12737 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 12699..12737 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 12699..12737 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 12699..12737 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 14177..14279 | - | 103 | NuclAT_0 | - | - |
| - | 14177..14279 | - | 103 | NuclAT_0 | - | - |
| - | 14177..14279 | - | 103 | NuclAT_0 | - | - |
| - | 14177..14279 | - | 103 | NuclAT_0 | - | - |
| AM342_RS26425 | 14291..15010 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| AM342_RS26430 | 15007..15441 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| AM342_RS26435 | 15496..17454 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(B) / dfrA17 / aadA5 / qacE / sul1 / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / blaTEM-1B / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / aac(3)-IId | - | 1..139059 | 139059 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T88973 WP_001312861.1 NZ_CP024863:c12655-12497 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T88973 NZ_CP024863:c12655-12497 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGAGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGAGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 39 bp
>AT88973 NZ_CP024863:c12737-12699 [Escherichia coli]
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|