Detailed information of TA system TA088931

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 151758..151991
• Replicon: plasmid unitig_1_pilon
• Accession: NZ_CP024860
• Organism: Escherichia coli strain AR_0014

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: AM341_RS25710
• Protein ID: WP_001312861.1
• Coordinates: 151833..151991 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	151758..151789 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AM341_RS25660	146977..147195	+	219	WP_001496291.1	hypothetical protein	-
AM341_RS26665	147605..147811	+	207	WP_000275856.1	hypothetical protein	-
AM341_RS25680	147837..148376	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
AM341_RS25685	148444..148677	+	234	WP_000005990.1	DUF905 family protein	-
AM341_RS25690	148705..148902	+	198	Protein_166	hypothetical protein	-
AM341_RS25695	148957..149391	+	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
AM341_RS25700	149388..150107	+	720	WP_001276238.1	plasmid SOS inhibition protein A	-
AM341_RS26475	150119..150307	-	189	WP_001299721.1	hypothetical protein	-
-	150119..150316	+	198	NuclAT_0	-	-
-	150119..150316	+	198	NuclAT_0	-	-
-	150119..150316	+	198	NuclAT_0	-	-
-	150119..150316	+	198	NuclAT_0	-	-
AM341_RS25705	150364..151733	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
-	151758..151789	+	32	NuclAT_1	-	Antitoxin
-	151758..151789	+	32	NuclAT_1	-	Antitoxin
-	151758..151789	+	32	NuclAT_1	-	Antitoxin
-	151758..151789	+	32	NuclAT_1	-	Antitoxin
AM341_RS25710	151833..151991	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
AM341_RS25725	152912..153199	+	288	WP_000107535.1	hypothetical protein	-
AM341_RS25730	153317..154138	+	822	WP_001234426.1	DUF945 domain-containing protein	-
AM341_RS25735	154435..155037	-	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
AM341_RS25740	155358..155741	+	384	WP_001151524.1	relaxosome protein TraM	-
AM341_RS25745	155928..156617	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
AM341_RS25750	156716..156973	+	258	Protein_177	TraY domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / sitABCD	senB / iucA / iucB / iucC / iucD / iutA	1..172588	172588

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T88931 WP_001312861.1 NZ_CP024860:151833-151991 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

>T88931 NZ_CP024860:151833-151991 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 32 bp

>AT88931 NZ_CP024860:151758-151789 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin