Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 151758..151991 | Replicon | plasmid unitig_1_pilon |
| Accession | NZ_CP024860 | ||
| Organism | Escherichia coli strain AR_0014 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | AM341_RS25710 | Protein ID | WP_001312861.1 |
| Coordinates | 151833..151991 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 151758..151789 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM341_RS25660 | 146977..147195 | + | 219 | WP_001496291.1 | hypothetical protein | - |
| AM341_RS26665 | 147605..147811 | + | 207 | WP_000275856.1 | hypothetical protein | - |
| AM341_RS25680 | 147837..148376 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| AM341_RS25685 | 148444..148677 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| AM341_RS25690 | 148705..148902 | + | 198 | Protein_166 | hypothetical protein | - |
| AM341_RS25695 | 148957..149391 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| AM341_RS25700 | 149388..150107 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| AM341_RS26475 | 150119..150307 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 150119..150316 | + | 198 | NuclAT_0 | - | - |
| - | 150119..150316 | + | 198 | NuclAT_0 | - | - |
| - | 150119..150316 | + | 198 | NuclAT_0 | - | - |
| - | 150119..150316 | + | 198 | NuclAT_0 | - | - |
| AM341_RS25705 | 150364..151733 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 151758..151789 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 151758..151789 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 151758..151789 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 151758..151789 | + | 32 | NuclAT_1 | - | Antitoxin |
| AM341_RS25710 | 151833..151991 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| AM341_RS25725 | 152912..153199 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| AM341_RS25730 | 153317..154138 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| AM341_RS25735 | 154435..155037 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| AM341_RS25740 | 155358..155741 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| AM341_RS25745 | 155928..156617 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| AM341_RS25750 | 156716..156973 | + | 258 | Protein_177 | TraY domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / sitABCD | senB / iucA / iucB / iucC / iucD / iutA | 1..172588 | 172588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T88931 WP_001312861.1 NZ_CP024860:151833-151991 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T88931 NZ_CP024860:151833-151991 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 32 bp
>AT88931 NZ_CP024860:151758-151789 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|