Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 2520441..2520589 | Replicon | chromosome |
Accession | NZ_CP024809 | ||
Organism | Staphylococcus haemolyticus strain 83131A |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | CUZ62_RS12785 | Protein ID | WP_011276848.1 |
Coordinates | 2520494..2520589 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2520441..2520476 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CUZ62_RS12220 | 2516117..2516254 | - | 138 | Protein_2346 | NAD(P)H-dependent oxidoreductase | - |
CUZ62_RS12225 | 2516396..2517526 | - | 1131 | WP_033080168.1 | NADH-dependent flavin oxidoreductase | - |
CUZ62_RS12230 | 2517728..2518150 | - | 423 | WP_033080167.1 | MarR family transcriptional regulator | - |
CUZ62_RS12235 | 2518794..2519396 | - | 603 | WP_011276850.1 | hypothetical protein | - |
CUZ62_RS12240 | 2519608..2520300 | - | 693 | WP_103416071.1 | nucleotidyltransferase | - |
- | 2520441..2520476 | - | 36 | - | - | Antitoxin |
CUZ62_RS12785 | 2520494..2520589 | - | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CUZ62_RS12900 | 2520784..2520930 | - | 147 | WP_000668388.1 | hypothetical protein | - |
CUZ62_RS12245 | 2521054..2521358 | - | 305 | Protein_2353 | hypothetical protein | - |
CUZ62_RS12250 | 2521497..2521880 | - | 384 | WP_011276846.1 | effector binding domain-containing protein | - |
CUZ62_RS12255 | 2522120..2522650 | - | 531 | WP_011276845.1 | N-acetyltransferase | - |
CUZ62_RS12905 | 2523254..2523511 | - | 258 | Protein_2356 | replication initiation protein | - |
CUZ62_RS12270 | 2524204..2524521 | + | 318 | Protein_2357 | IS200/IS605-like element ISSep3 family transposase | - |
CUZ62_RS12275 | 2524629..2524862 | - | 234 | WP_016931184.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2524204..2524524 | 320 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T88556 WP_011276848.1 NZ_CP024809:c2520589-2520494 [Staphylococcus haemolyticus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T88556 NZ_CP024809:c2520589-2520494 [Staphylococcus haemolyticus]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT88556 NZ_CP024809:c2520476-2520441 [Staphylococcus haemolyticus]
TACAACAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAACAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|