Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 50479..50749 | Replicon | plasmid pBH100-1 |
| Accession | NZ_CP024652 | ||
| Organism | Escherichia coli strain BH100 substr. MG2014 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | CDW44_RS26230 | Protein ID | WP_001312861.1 |
| Coordinates | 50591..50749 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 50479..50542 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CDW44_RS26195 | 46100..46693 | - | 594 | WP_000428546.1 | tetracyline resistance-associated transcriptional repressor TetC | - |
| CDW44_RS26200 | 46826..47197 | + | 372 | WP_035689358.1 | helix-turn-helix domain-containing protein | - |
| CDW44_RS26205 | 47207..48415 | - | 1209 | WP_001352368.1 | IS4-like element ISVsa5 family transposase | - |
| CDW44_RS26215 | 48525..49106 | + | 582 | Protein_54 | hypothetical protein | - |
| CDW44_RS26220 | 49161..49595 | + | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
| CDW44_RS26225 | 49592..50311 | + | 720 | WP_000116348.1 | plasmid SOS inhibition protein A | - |
| - | 50323..50547 | + | 225 | NuclAT_0 | - | - |
| - | 50323..50547 | + | 225 | NuclAT_0 | - | - |
| - | 50323..50547 | + | 225 | NuclAT_0 | - | - |
| - | 50323..50547 | + | 225 | NuclAT_0 | - | - |
| CDW44_RS27025 | 50332..50511 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 50479..50542 | - | 64 | - | - | Antitoxin |
| CDW44_RS26230 | 50591..50749 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| CDW44_RS27140 | 50987..51364 | - | 378 | Protein_59 | hypothetical protein | - |
| CDW44_RS26250 | 51663..51959 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| CDW44_RS26255 | 52070..52891 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| CDW44_RS26260 | 53186..53788 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| CDW44_RS26270 | 54111..54494 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| CDW44_RS26275 | 54688..55359 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| CDW44_RS26280 | 55496..55723 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / ant(3'')-Ia / catA1 / aph(3')-Ia / tet(B) / blaTEM-1A | - | 1..107274 | 107274 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T88181 WP_001312861.1 NZ_CP024652:50591-50749 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T88181 NZ_CP024652:50591-50749 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT88181 NZ_CP024652:c50542-50479 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|