Detailed information of TA system TA087763

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 907090..907310
• Replicon: chromosome
• Accession: NZ_CP024479
• Organism: Escherichia coli strain 2011C-4315

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: A5958_RS05110
• Protein ID: WP_000170965.1
• Coordinates: 907203..907310 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	907090..907156 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
A5958_RS05080	902369..903763	-	1395	WP_000086212.1	inverse autotransporter invasin YchO	-
A5958_RS05085	903948..904301	+	354	WP_001169666.1	DsrE/F sulfur relay family protein YchN	-
A5958_RS05090	904345..905040	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
A5958_RS05095	905198..905428	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
A5958_RS05100	905698..906798	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	907090..907156	-	67	-	-	Antitoxin
A5958_RS05110	907203..907310	+	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	907623..907686	-	64	NuclAT_33	-	-
-	907623..907686	-	64	NuclAT_33	-	-
-	907623..907686	-	64	NuclAT_33	-	-
-	907623..907686	-	64	NuclAT_33	-	-
-	907623..907686	-	64	NuclAT_35	-	-
-	907623..907686	-	64	NuclAT_35	-	-
-	907623..907686	-	64	NuclAT_35	-	-
-	907623..907686	-	64	NuclAT_35	-	-
-	907623..907686	-	64	NuclAT_37	-	-
-	907623..907686	-	64	NuclAT_37	-	-
-	907623..907686	-	64	NuclAT_37	-	-
-	907623..907686	-	64	NuclAT_37	-	-
-	907623..907686	-	64	NuclAT_39	-	-
-	907623..907686	-	64	NuclAT_39	-	-
-	907623..907686	-	64	NuclAT_39	-	-
-	907623..907686	-	64	NuclAT_39	-	-
-	907623..907686	-	64	NuclAT_41	-	-
-	907623..907686	-	64	NuclAT_41	-	-
-	907623..907686	-	64	NuclAT_41	-	-
-	907623..907686	-	64	NuclAT_41	-	-
-	907623..907686	-	64	NuclAT_43	-	-
-	907623..907686	-	64	NuclAT_43	-	-
-	907623..907686	-	64	NuclAT_43	-	-
-	907623..907686	-	64	NuclAT_43	-	-
-	907624..907686	-	63	NuclAT_45	-	-
-	907624..907686	-	63	NuclAT_45	-	-
-	907624..907686	-	63	NuclAT_45	-	-
-	907624..907686	-	63	NuclAT_45	-	-
-	907624..907686	-	63	NuclAT_48	-	-
-	907624..907686	-	63	NuclAT_48	-	-
-	907624..907686	-	63	NuclAT_48	-	-
-	907624..907686	-	63	NuclAT_48	-	-
-	907625..907686	-	62	NuclAT_15	-	-
-	907625..907686	-	62	NuclAT_15	-	-
-	907625..907686	-	62	NuclAT_15	-	-
-	907625..907686	-	62	NuclAT_15	-	-
-	907625..907686	-	62	NuclAT_18	-	-
-	907625..907686	-	62	NuclAT_18	-	-
-	907625..907686	-	62	NuclAT_18	-	-
-	907625..907686	-	62	NuclAT_18	-	-
-	907625..907686	-	62	NuclAT_21	-	-
-	907625..907686	-	62	NuclAT_21	-	-
-	907625..907686	-	62	NuclAT_21	-	-
-	907625..907686	-	62	NuclAT_21	-	-
-	907625..907686	-	62	NuclAT_24	-	-
-	907625..907686	-	62	NuclAT_24	-	-
-	907625..907686	-	62	NuclAT_24	-	-
-	907625..907686	-	62	NuclAT_24	-	-
-	907625..907686	-	62	NuclAT_27	-	-
-	907625..907686	-	62	NuclAT_27	-	-
-	907625..907686	-	62	NuclAT_27	-	-
-	907625..907686	-	62	NuclAT_27	-	-
-	907625..907686	-	62	NuclAT_30	-	-
-	907625..907686	-	62	NuclAT_30	-	-
-	907625..907686	-	62	NuclAT_30	-	-
-	907625..907686	-	62	NuclAT_30	-	-
A5958_RS05115	907739..907846	+	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	908160..908226	-	67	NuclAT_44	-	-
-	908160..908226	-	67	NuclAT_44	-	-
-	908160..908226	-	67	NuclAT_44	-	-
-	908160..908226	-	67	NuclAT_44	-	-
-	908160..908226	-	67	NuclAT_47	-	-
-	908160..908226	-	67	NuclAT_47	-	-
-	908160..908226	-	67	NuclAT_47	-	-
-	908160..908226	-	67	NuclAT_47	-	-
-	908161..908224	-	64	NuclAT_16	-	-
-	908161..908224	-	64	NuclAT_16	-	-
-	908161..908224	-	64	NuclAT_16	-	-
-	908161..908224	-	64	NuclAT_16	-	-
-	908161..908224	-	64	NuclAT_19	-	-
-	908161..908224	-	64	NuclAT_19	-	-
-	908161..908224	-	64	NuclAT_19	-	-
-	908161..908224	-	64	NuclAT_19	-	-
-	908161..908224	-	64	NuclAT_22	-	-
-	908161..908224	-	64	NuclAT_22	-	-
-	908161..908224	-	64	NuclAT_22	-	-
-	908161..908224	-	64	NuclAT_22	-	-
-	908161..908224	-	64	NuclAT_25	-	-
-	908161..908224	-	64	NuclAT_25	-	-
-	908161..908224	-	64	NuclAT_25	-	-
-	908161..908224	-	64	NuclAT_25	-	-
-	908161..908224	-	64	NuclAT_28	-	-
-	908161..908224	-	64	NuclAT_28	-	-
-	908161..908224	-	64	NuclAT_28	-	-
-	908161..908224	-	64	NuclAT_28	-	-
-	908161..908224	-	64	NuclAT_31	-	-
-	908161..908224	-	64	NuclAT_31	-	-
-	908161..908224	-	64	NuclAT_31	-	-
-	908161..908224	-	64	NuclAT_31	-	-
A5958_RS05120	908274..908381	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
A5958_RS05125	908530..909384	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
A5958_RS05130	909420..910229	-	810	WP_001257044.1	invasion regulator SirB1	-
A5958_RS05135	910233..910625	-	393	WP_000200392.1	invasion regulator SirB2	-
A5958_RS05140	910622..911455	-	834	WP_000456459.1	peptide chain release factor N(5)-glutamine methyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T87763 WP_000170965.1 NZ_CP024479:907203-907310 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T87763 NZ_CP024479:907203-907310 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT87763 NZ_CP024479:c907156-907090 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin