Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 78632..78885 | Replicon | plasmid unnamed2 |
Accession | NZ_CP024475 | ||
Organism | Shigella flexneri 7b strain 94-3007 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | CPZ98_RS24205 | Protein ID | WP_001312851.1 |
Coordinates | 78736..78885 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 78632..78691 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CPZ98_RS24165 (74566) | 74566..75312 | + | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
CPZ98_RS24170 (75367) | 75367..75927 | + | 561 | WP_033807966.1 | fertility inhibition protein FinO | - |
CPZ98_RS24175 (76059) | 76059..76271 | + | 213 | WP_001301409.1 | ANR family transcriptional regulator | - |
CPZ98_RS24180 (76517) | 76517..76978 | + | 462 | WP_001233850.1 | thermonuclease family protein | - |
CPZ98_RS24185 (77024) | 77024..77233 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
CPZ98_RS24190 (77271) | 77271..77861 | + | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
CPZ98_RS24195 (78016) | 78016..78489 | + | 474 | WP_016240489.1 | hypothetical protein | - |
- (78632) | 78632..78691 | - | 60 | NuclAT_1 | - | Antitoxin |
- (78632) | 78632..78691 | - | 60 | NuclAT_1 | - | Antitoxin |
- (78632) | 78632..78691 | - | 60 | NuclAT_1 | - | Antitoxin |
- (78632) | 78632..78691 | - | 60 | NuclAT_1 | - | Antitoxin |
CPZ98_RS24205 (78736) | 78736..78885 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
CPZ98_RS24210 (79170) | 79170..79418 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
CPZ98_RS24220 (79663) | 79663..79737 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
CPZ98_RS24225 (79730) | 79730..80587 | + | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
CPZ98_RS24235 (81526) | 81526..82179 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
CPZ98_RS24240 (82272) | 82272..82529 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / aadA5 / qacE / sul1 / mph(A) / erm(B) | - | 1..82833 | 82833 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T87736 WP_001312851.1 NZ_CP024475:78736-78885 [Shigella flexneri 7b]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T87736 NZ_CP024475:78736-78885 [Shigella flexneri 7b]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT87736 NZ_CP024475:c78691-78632 [Shigella flexneri 7b]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|