Detailed information of TA system TA087733

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 37155..37424
• Replicon: plasmid unnamed2
• Accession: NZ_CP024475
• Organism: Shigella flexneri 7b strain 94-3007

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: CPZ98_RS23940
• Protein ID: WP_001372321.1
• Coordinates: 37299..37424 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	37155..37220 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CPZ98_RS23910	32991..33470	+	480	WP_130862260.1	single-stranded DNA-binding protein	-
CPZ98_RS23915	33526..33759	+	234	WP_000005971.1	DUF905 domain-containing protein	-
CPZ98_RS23920	33823..35781	+	1959	WP_112324844.1	ParB/RepB/Spo0J family partition protein	-
CPZ98_RS23925	35836..36270	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
CPZ98_RS23930	36267..37029	+	763	Protein_45	plasmid SOS inhibition protein A	-
-	36998..37222	+	225	NuclAT_0	-	-
-	36998..37222	+	225	NuclAT_0	-	-
-	36998..37222	+	225	NuclAT_0	-	-
-	36998..37222	+	225	NuclAT_0	-	-
CPZ98_RS23935	37007..37186	-	180	WP_001334662.1	hypothetical protein	-
-	37155..37220	+	66	-	-	Antitoxin
CPZ98_RS26685	37208..37357	+	150	Protein_47	plasmid maintenance protein Mok	-
CPZ98_RS23940	37299..37424	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
CPZ98_RS23945	37743..38039	-	297	Protein_49	hypothetical protein	-
CPZ98_RS23955	38339..38635	+	297	WP_001272251.1	hypothetical protein	-
CPZ98_RS23960	38746..39567	+	822	WP_001234445.1	DUF932 domain-containing protein	-
CPZ98_RS23965	39864..40454	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
CPZ98_RS23970	40787..41170	+	384	WP_001151529.1	conjugal transfer relaxosome DNA-binding protein TraM	-
CPZ98_RS23975	41362..42009	+	648	WP_128867105.1	transcriptional regulator TraJ family protein	-
CPZ98_RS23980	42129..42356	+	228	WP_000589556.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / aadA5 / qacE / sul1 / mph(A) / erm(B)	-	1..82833	82833

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T87733 WP_001372321.1 NZ_CP024475:37299-37424 [Shigella flexneri 7b]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T87733 NZ_CP024475:37299-37424 [Shigella flexneri 7b]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT87733 NZ_CP024475:37155-37220 [Shigella flexneri 7b]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin