Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4027378..4027603 | Replicon | chromosome |
Accession | NZ_CP024473 | ||
Organism | Shigella flexneri 7b strain 94-3007 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CPZ98_RS20705 | Protein ID | WP_000813254.1 |
Coordinates | 4027378..4027533 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4027545..4027603 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CPZ98_RS20640 | 4022690..4023040 | - | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
CPZ98_RS20645 | 4023037..4023711 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
CPZ98_RS20650 | 4023810..4024025 | - | 216 | WP_000839572.1 | class II holin family protein | - |
CPZ98_RS20680 | 4024821..4025509 | - | 689 | Protein_3972 | bacteriophage antitermination protein Q | - |
CPZ98_RS20685 | 4025506..4025871 | - | 366 | WP_128832266.1 | RusA family crossover junction endodeoxyribonuclease | - |
CPZ98_RS20690 | 4025872..4026930 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
CPZ98_RS20695 | 4026932..4027210 | - | 279 | WP_011069426.1 | hypothetical protein | - |
CPZ98_RS20705 | 4027378..4027533 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 4027545..4027603 | + | 59 | - | - | Antitoxin |
CPZ98_RS20720 | 4028185..4028601 | - | 417 | WP_005069274.1 | hypothetical protein | - |
CPZ98_RS20725 | 4028628..4028768 | + | 141 | Protein_3978 | DUF4224 domain-containing protein | - |
CPZ98_RS20730 | 4028768..4029808 | + | 1041 | WP_005096324.1 | tyrosine-type recombinase/integrase | - |
CPZ98_RS20740 | 4030019..4030816 | + | 798 | WP_024260703.1 | DgsA anti-repressor MtfA | - |
CPZ98_RS20750 | 4031154..4032416 | + | 1263 | Protein_3981 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 3994078..4035724 | 41646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T87731 WP_000813254.1 NZ_CP024473:c4027533-4027378 [Shigella flexneri 7b]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T87731 NZ_CP024473:c4027533-4027378 [Shigella flexneri 7b]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT87731 NZ_CP024473:4027545-4027603 [Shigella flexneri 7b]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|