Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3371038..3371263 | Replicon | chromosome |
Accession | NZ_CP024473 | ||
Organism | Shigella flexneri 7b strain 94-3007 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CPZ98_RS17035 | Protein ID | WP_000813254.1 |
Coordinates | 3371108..3371263 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3371038..3371096 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CPZ98_RS26500 | 3367039..3367208 | + | 170 | Protein_3270 | hypothetical protein | - |
CPZ98_RS17000 | 3367354..3368097 | + | 744 | WP_000788999.1 | ATP-binding protein | - |
CPZ98_RS17005 | 3368112..3368534 | + | 423 | WP_001118167.1 | DUF977 family protein | - |
CPZ98_RS17010 | 3368592..3368948 | + | 357 | WP_005048249.1 | hypothetical protein | - |
CPZ98_RS17015 | 3369041..3369259 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
CPZ98_RS17020 | 3369261..3369626 | + | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
CPZ98_RS17025 | 3369623..3370288 | + | 666 | WP_000208062.1 | hypothetical protein | - |
CPZ98_RS17030 | 3370288..3370653 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
- | 3371038..3371096 | - | 59 | - | - | Antitoxin |
CPZ98_RS17035 | 3371108..3371263 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
CPZ98_RS17050 | 3372600..3373199 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
CPZ98_RS17055 | 3373199..3373489 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
CPZ98_RS17060 | 3373486..3374040 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
CPZ98_RS17065 | 3374193..3374366 | + | 174 | WP_000504450.1 | hypothetical protein | - |
CPZ98_RS17070 | 3374428..3375584 | + | 1157 | WP_094081550.1 | IS3-like element IS600 family transposase | - |
CPZ98_RS17075 | 3375577..3376137 | + | 561 | WP_072075205.1 | ORF6N domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 3360475..3407755 | 47280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T87720 WP_000813254.1 NZ_CP024473:3371108-3371263 [Shigella flexneri 7b]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T87720 NZ_CP024473:3371108-3371263 [Shigella flexneri 7b]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT87720 NZ_CP024473:c3371096-3371038 [Shigella flexneri 7b]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|