Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3241346..3241566 | Replicon | chromosome |
| Accession | NZ_CP024473 | ||
| Organism | Shigella flexneri 7b strain 94-3007 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A4P7TT65 |
| Locus tag | CPZ98_RS16350 | Protein ID | WP_000170961.1 |
| Coordinates | 3241346..3241453 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3241500..3241566 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CPZ98_RS16325 | 3237190..3238272 | + | 1083 | WP_075332729.1 | peptide chain release factor 1 | - |
| CPZ98_RS16330 | 3238272..3239105 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| CPZ98_RS16335 | 3239102..3239494 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| CPZ98_RS16340 | 3239498..3240307 | + | 810 | WP_001257041.1 | invasion regulator SirB1 | - |
| CPZ98_RS16345 | 3240343..3241197 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| CPZ98_RS16350 | 3241346..3241453 | - | 108 | WP_000170961.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3241500..3241566 | + | 67 | - | - | Antitoxin |
| CPZ98_RS16355 | 3241858..3242958 | - | 1101 | WP_000063614.1 | sodium-potassium/proton antiporter ChaA | - |
| CPZ98_RS16360 | 3243228..3243458 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| CPZ98_RS16365 | 3243616..3244311 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| CPZ98_RS16370 | 3244355..3244708 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| CPZ98_RS16375 | 3244893..3246287 | + | 1395 | WP_000086222.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T87718 WP_000170961.1 NZ_CP024473:c3241453-3241346 [Shigella flexneri 7b]
MTLAQFAMTFWHDLAAPILAGIIAAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIIAAAIVSWWRNRK
Download Length: 108 bp
>T87718 NZ_CP024473:c3241453-3241346 [Shigella flexneri 7b]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTGCCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTGCCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT87718 NZ_CP024473:3241500-3241566 [Shigella flexneri 7b]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|