Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1056888..1057110 | Replicon | chromosome |
| Accession | NZ_CP024473 | ||
| Organism | Shigella flexneri 7b strain 94-3007 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | CPZ98_RS05345 | Protein ID | WP_001295224.1 |
| Coordinates | 1056888..1056995 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1057044..1057110 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CPZ98_RS05300 | 1051917..1053488 | + | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| CPZ98_RS05305 | 1053485..1053676 | + | 192 | WP_000988299.1 | cellulose biosynthesis protein BcsF | - |
| CPZ98_RS05310 | 1053673..1055352 | + | 1680 | WP_000191557.1 | cellulose biosynthesis protein BcsG | - |
| CPZ98_RS05315 | 1055439..1055546 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1055603..1055658 | + | 56 | NuclAT_28 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_28 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_28 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_28 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_31 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_31 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_31 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_31 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_34 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_34 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_34 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_34 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_37 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_37 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_37 | - | - |
| - | 1055603..1055658 | + | 56 | NuclAT_37 | - | - |
| - | 1055603..1055660 | + | 58 | NuclAT_22 | - | - |
| - | 1055603..1055660 | + | 58 | NuclAT_22 | - | - |
| - | 1055603..1055660 | + | 58 | NuclAT_22 | - | - |
| - | 1055603..1055660 | + | 58 | NuclAT_22 | - | - |
| - | 1055603..1055660 | + | 58 | NuclAT_25 | - | - |
| - | 1055603..1055660 | + | 58 | NuclAT_25 | - | - |
| - | 1055603..1055660 | + | 58 | NuclAT_25 | - | - |
| - | 1055603..1055660 | + | 58 | NuclAT_25 | - | - |
| CPZ98_RS05325 | 1055922..1056029 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1056086..1056141 | + | 56 | NuclAT_30 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_30 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_30 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_30 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_33 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_33 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_33 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_33 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_36 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_36 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_36 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_36 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_39 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_39 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_39 | - | - |
| - | 1056086..1056141 | + | 56 | NuclAT_39 | - | - |
| - | 1056086..1056143 | + | 58 | NuclAT_24 | - | - |
| - | 1056086..1056143 | + | 58 | NuclAT_24 | - | - |
| - | 1056086..1056143 | + | 58 | NuclAT_24 | - | - |
| - | 1056086..1056143 | + | 58 | NuclAT_24 | - | - |
| - | 1056086..1056143 | + | 58 | NuclAT_27 | - | - |
| - | 1056086..1056143 | + | 58 | NuclAT_27 | - | - |
| - | 1056086..1056143 | + | 58 | NuclAT_27 | - | - |
| - | 1056086..1056143 | + | 58 | NuclAT_27 | - | - |
| CPZ98_RS05335 | 1056405..1056512 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | - |
| - | 1056570..1056624 | + | 55 | NuclAT_29 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_29 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_29 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_29 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_32 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_32 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_32 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_32 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_35 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_35 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_35 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_35 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_38 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_38 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_38 | - | - |
| - | 1056570..1056624 | + | 55 | NuclAT_38 | - | - |
| - | 1056570..1056626 | + | 57 | NuclAT_23 | - | - |
| - | 1056570..1056626 | + | 57 | NuclAT_23 | - | - |
| - | 1056570..1056626 | + | 57 | NuclAT_23 | - | - |
| - | 1056570..1056626 | + | 57 | NuclAT_23 | - | - |
| - | 1056570..1056626 | + | 57 | NuclAT_26 | - | - |
| - | 1056570..1056626 | + | 57 | NuclAT_26 | - | - |
| - | 1056570..1056626 | + | 57 | NuclAT_26 | - | - |
| - | 1056570..1056626 | + | 57 | NuclAT_26 | - | - |
| CPZ98_RS05345 | 1056888..1056995 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1057044..1057110 | + | 67 | - | - | Antitoxin |
| CPZ98_RS05350 | 1057471..1058742 | + | 1272 | WP_005052340.1 | aromatic amino acid transport family protein | - |
| CPZ98_RS05355 | 1058772..1059776 | - | 1005 | WP_000107041.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| CPZ98_RS05360 | 1059773..1060756 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| CPZ98_RS05365 | 1060767..1061669 | - | 903 | WP_000084666.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T87711 WP_001295224.1 NZ_CP024473:c1056995-1056888 [Shigella flexneri 7b]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T87711 NZ_CP024473:c1056995-1056888 [Shigella flexneri 7b]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAG
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAG
Antitoxin
Download Length: 67 bp
>AT87711 NZ_CP024473:1057044-1057110 [Shigella flexneri 7b]
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|