Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 87369..87633 | Replicon | plasmid pBU53M1 |
| Accession | NZ_CP024468 | ||
| Organism | Shigella dysenteriae strain BU53M1 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | CPZ97_RS25155 | Protein ID | WP_001387489.1 |
| Coordinates | 87369..87521 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 87573..87633 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CPZ97_RS25125 | 83769..84383 | + | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| CPZ97_RS25130 | 84481..84690 | + | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
| CPZ97_RS25135 | 84934..85596 | + | 663 | WP_042078443.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| CPZ97_RS25140 | 85668..85877 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| CPZ97_RS27885 | 86209..86385 | + | 177 | WP_001054900.1 | hypothetical protein | - |
| CPZ97_RS25145 | 86450..86746 | - | 297 | WP_011264046.1 | hypothetical protein | - |
| CPZ97_RS25150 | 87046..87297 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| CPZ97_RS25155 | 87369..87521 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - | 87573..87633 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 87573..87633 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 87573..87633 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 87573..87633 | + | 61 | NuclAT_0 | - | Antitoxin |
| CPZ97_RS25160 | 87836..88927 | + | 1092 | WP_000426061.1 | hypothetical protein | - |
| CPZ97_RS25165 | 89234..90442 | + | 1209 | WP_000121263.1 | IncI1-type conjugal transfer protein TrbA | - |
| CPZ97_RS25170 | 90461..91531 | + | 1071 | WP_050197982.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | catA1 / dfrA1 / ant(3'')-Ia / qacE / sul1 / tet(A) | - | 1..115922 | 115922 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T87700 WP_001387489.1 NZ_CP024468:c87521-87369 [Shigella dysenteriae]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T87700 NZ_CP024468:c87521-87369 [Shigella dysenteriae]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT87700 NZ_CP024468:87573-87633 [Shigella dysenteriae]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|