Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 36229..36499 | Replicon | plasmid unnamed2 |
Accession | NZ_CP024284 | ||
Organism | Escherichia albertii strain 2014C-4356 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CCF14_RS25400 | Protein ID | WP_001312861.1 |
Coordinates | 36341..36499 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 36229..36292 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CCF14_RS28305 | 31519..31731 | + | 213 | WP_001208963.1 | hypothetical protein | - |
CCF14_RS28510 | 31767..31973 | + | 207 | WP_000547971.1 | hypothetical protein | - |
CCF14_RS25375 | 31999..32538 | + | 540 | WP_009426937.1 | single-stranded DNA-binding protein | - |
CCF14_RS25380 | 32600..32833 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
CCF14_RS25385 | 32898..34856 | + | 1959 | WP_099588204.1 | ParB/RepB/Spo0J family partition protein | - |
CCF14_RS25390 | 34911..35345 | + | 435 | WP_032217500.1 | conjugation system SOS inhibitor PsiB | - |
CCF14_RS25395 | 35342..36061 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
CCF14_RS28310 | 36073..36261 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 36073..36297 | + | 225 | NuclAT_0 | - | - |
- | 36073..36297 | + | 225 | NuclAT_0 | - | - |
- | 36073..36297 | + | 225 | NuclAT_0 | - | - |
- | 36073..36297 | + | 225 | NuclAT_0 | - | - |
- | 36229..36292 | - | 64 | - | - | Antitoxin |
CCF14_RS25400 | 36341..36499 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CCF14_RS25410 | 36942..37154 | + | 213 | WP_100030856.1 | hypothetical protein | - |
CCF14_RS28515 | 37190..37396 | + | 207 | WP_000547971.1 | hypothetical protein | - |
CCF14_RS25420 | 37421..37708 | + | 288 | WP_000107535.1 | hypothetical protein | - |
CCF14_RS25425 | 37826..38647 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
CCF14_RS25430 | 38944..39534 | - | 591 | WP_165850686.1 | transglycosylase SLT domain-containing protein | - |
CCF14_RS25440 | 39869..40252 | + | 384 | WP_021559009.1 | relaxosome protein TraM | - |
CCF14_RS25445 | 40446..41117 | + | 672 | WP_032083167.1 | conjugal transfer transcriptional regulator TraJ | - |
CCF14_RS25450 | 41254..41481 | + | 228 | WP_000089265.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..59626 | 59626 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T87549 WP_001312861.1 NZ_CP024284:36341-36499 [Escherichia albertii]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T87549 NZ_CP024284:36341-36499 [Escherichia albertii]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT87549 NZ_CP024284:c36292-36229 [Escherichia albertii]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|