Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 67179..67448 | Replicon | plasmid unnamed3 |
Accession | NZ_CP024281 | ||
Organism | Escherichia coli strain ATCC 43896 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CS031_RS27460 | Protein ID | WP_001312861.1 |
Coordinates | 67290..67448 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 67179..67244 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CS031_RS28165 | 62248..62502 | + | 255 | WP_072254791.1 | hypothetical protein | - |
CS031_RS27435 | 62972..63499 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
CS031_RS27440 | 63555..63788 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
CS031_RS27445 | 63847..65805 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
CS031_RS27450 | 65860..66294 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
CS031_RS27455 | 66291..67010 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
CS031_RS27960 | 67022..67210 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 67022..67246 | + | 225 | NuclAT_0 | - | - |
- | 67022..67246 | + | 225 | NuclAT_0 | - | - |
- | 67022..67246 | + | 225 | NuclAT_0 | - | - |
- | 67022..67246 | + | 225 | NuclAT_0 | - | - |
- | 67179..67244 | + | 66 | - | - | Antitoxin |
CS031_RS27460 | 67290..67448 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CS031_RS27485 | 68367..68654 | + | 288 | WP_000107537.1 | hypothetical protein | - |
CS031_RS27490 | 68774..69595 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
CS031_RS27495 | 69892..70539 | - | 648 | WP_000614282.1 | transglycosylase SLT domain-containing protein | - |
CS031_RS27500 | 70825..71208 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
CS031_RS27505 | 71402..72088 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
CS031_RS27510 | 72182..72409 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | ant(3'')-Ia / qacE / sul1 | - | 1..84894 | 84894 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T87514 WP_001312861.1 NZ_CP024281:67290-67448 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T87514 NZ_CP024281:67290-67448 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT87514 NZ_CP024281:67179-67244 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|