Detailed information of TA system TA087465

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1377246..1377468
• Replicon: chromosome
• Accession: NZ_CP024275
• Organism: Escherichia coli O6:H16 strain M9682-C1

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: COG40_RS07185
• Protein ID: WP_000170965.1
• Coordinates: 1377246..1377353 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1377401..1377468 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
COG40_RS07160	1373092..1374174	+	1083	WP_000804732.1	peptide chain release factor 1	-
COG40_RS07165	1374174..1375007	+	834	WP_000456454.1	peptide chain release factor N(5)-glutamine methyltransferase	-
COG40_RS07170	1375004..1375396	+	393	WP_001705045.1	invasion regulator SirB2	-
COG40_RS07175	1375400..1376209	+	810	WP_001257044.1	invasion regulator SirB1	-
COG40_RS07180	1376245..1377099	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
COG40_RS07185	1377246..1377353	-	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	1377401..1377468	+	68	NuclAT_14	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_14	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_14	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_14	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_16	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_16	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_16	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_16	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_18	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_18	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_18	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_18	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_20	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_20	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_20	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_20	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_22	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_22	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_22	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_22	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_24	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_24	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_24	-	Antitoxin
-	1377401..1377468	+	68	NuclAT_24	-	Antitoxin
COG40_RS07190	1377781..1377888	-	108	WP_000170963.1	small toxic polypeptide LdrB	-
-	1377936..1378002	+	67	NuclAT_26	-	-
-	1377936..1378002	+	67	NuclAT_26	-	-
-	1377936..1378002	+	67	NuclAT_26	-	-
-	1377936..1378002	+	67	NuclAT_26	-	-
-	1377936..1378002	+	67	NuclAT_27	-	-
-	1377936..1378002	+	67	NuclAT_27	-	-
-	1377936..1378002	+	67	NuclAT_27	-	-
-	1377936..1378002	+	67	NuclAT_27	-	-
-	1377936..1378002	+	67	NuclAT_28	-	-
-	1377936..1378002	+	67	NuclAT_28	-	-
-	1377936..1378002	+	67	NuclAT_28	-	-
-	1377936..1378002	+	67	NuclAT_28	-	-
-	1377936..1378002	+	67	NuclAT_29	-	-
-	1377936..1378002	+	67	NuclAT_29	-	-
-	1377936..1378002	+	67	NuclAT_29	-	-
-	1377936..1378002	+	67	NuclAT_29	-	-
-	1377936..1378002	+	67	NuclAT_30	-	-
-	1377936..1378002	+	67	NuclAT_30	-	-
-	1377936..1378002	+	67	NuclAT_30	-	-
-	1377936..1378002	+	67	NuclAT_30	-	-
-	1377936..1378002	+	67	NuclAT_31	-	-
-	1377936..1378002	+	67	NuclAT_31	-	-
-	1377936..1378002	+	67	NuclAT_31	-	-
-	1377936..1378002	+	67	NuclAT_31	-	-
-	1377938..1378003	+	66	NuclAT_15	-	-
-	1377938..1378003	+	66	NuclAT_15	-	-
-	1377938..1378003	+	66	NuclAT_15	-	-
-	1377938..1378003	+	66	NuclAT_15	-	-
-	1377938..1378003	+	66	NuclAT_17	-	-
-	1377938..1378003	+	66	NuclAT_17	-	-
-	1377938..1378003	+	66	NuclAT_17	-	-
-	1377938..1378003	+	66	NuclAT_17	-	-
-	1377938..1378003	+	66	NuclAT_19	-	-
-	1377938..1378003	+	66	NuclAT_19	-	-
-	1377938..1378003	+	66	NuclAT_19	-	-
-	1377938..1378003	+	66	NuclAT_19	-	-
-	1377938..1378003	+	66	NuclAT_21	-	-
-	1377938..1378003	+	66	NuclAT_21	-	-
-	1377938..1378003	+	66	NuclAT_21	-	-
-	1377938..1378003	+	66	NuclAT_21	-	-
-	1377938..1378003	+	66	NuclAT_23	-	-
-	1377938..1378003	+	66	NuclAT_23	-	-
-	1377938..1378003	+	66	NuclAT_23	-	-
-	1377938..1378003	+	66	NuclAT_23	-	-
-	1377938..1378003	+	66	NuclAT_25	-	-
-	1377938..1378003	+	66	NuclAT_25	-	-
-	1377938..1378003	+	66	NuclAT_25	-	-
-	1377938..1378003	+	66	NuclAT_25	-	-
COG40_RS07195	1378293..1379393	-	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
COG40_RS07200	1379663..1379893	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
COG40_RS07205	1380051..1380746	+	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
COG40_RS07210	1380790..1381143	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T87465 WP_000170965.1 NZ_CP024275:c1377353-1377246 [Escherichia coli O6:H16]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T87465 NZ_CP024275:c1377353-1377246 [Escherichia coli O6:H16]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 68 bp

>AT87465 NZ_CP024275:1377401-1377468 [Escherichia coli O6:H16]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin