Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4974079..4974299 Replicon chromosome
Accession NZ_CP024243
Organism Escherichia coli O128:H27 strain 90-9281

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag COG34_RS25800 Protein ID WP_000170965.1
Coordinates 4974192..4974299 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4974079..4974145 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
COG34_RS25775 4969358..4970752 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
COG34_RS25780 4970937..4971290 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
COG34_RS25785 4971334..4972029 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
COG34_RS25790 4972187..4972417 - 231 WP_001146442.1 putative cation transport regulator ChaB -
COG34_RS25795 4972687..4973787 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 4974079..4974145 - 67 - - Antitoxin
COG34_RS25800 4974192..4974299 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4974612..4974675 - 64 NuclAT_32 - -
- 4974612..4974675 - 64 NuclAT_32 - -
- 4974612..4974675 - 64 NuclAT_32 - -
- 4974612..4974675 - 64 NuclAT_32 - -
- 4974612..4974675 - 64 NuclAT_35 - -
- 4974612..4974675 - 64 NuclAT_35 - -
- 4974612..4974675 - 64 NuclAT_35 - -
- 4974612..4974675 - 64 NuclAT_35 - -
- 4974612..4974675 - 64 NuclAT_38 - -
- 4974612..4974675 - 64 NuclAT_38 - -
- 4974612..4974675 - 64 NuclAT_38 - -
- 4974612..4974675 - 64 NuclAT_38 - -
- 4974612..4974675 - 64 NuclAT_41 - -
- 4974612..4974675 - 64 NuclAT_41 - -
- 4974612..4974675 - 64 NuclAT_41 - -
- 4974612..4974675 - 64 NuclAT_41 - -
- 4974612..4974675 - 64 NuclAT_44 - -
- 4974612..4974675 - 64 NuclAT_44 - -
- 4974612..4974675 - 64 NuclAT_44 - -
- 4974612..4974675 - 64 NuclAT_44 - -
- 4974612..4974675 - 64 NuclAT_47 - -
- 4974612..4974675 - 64 NuclAT_47 - -
- 4974612..4974675 - 64 NuclAT_47 - -
- 4974612..4974675 - 64 NuclAT_47 - -
- 4974613..4974675 - 63 NuclAT_49 - -
- 4974613..4974675 - 63 NuclAT_49 - -
- 4974613..4974675 - 63 NuclAT_49 - -
- 4974613..4974675 - 63 NuclAT_49 - -
- 4974613..4974675 - 63 NuclAT_52 - -
- 4974613..4974675 - 63 NuclAT_52 - -
- 4974613..4974675 - 63 NuclAT_52 - -
- 4974613..4974675 - 63 NuclAT_52 - -
- 4974613..4974675 - 63 NuclAT_55 - -
- 4974613..4974675 - 63 NuclAT_55 - -
- 4974613..4974675 - 63 NuclAT_55 - -
- 4974613..4974675 - 63 NuclAT_55 - -
- 4974613..4974675 - 63 NuclAT_58 - -
- 4974613..4974675 - 63 NuclAT_58 - -
- 4974613..4974675 - 63 NuclAT_58 - -
- 4974613..4974675 - 63 NuclAT_58 - -
- 4974614..4974675 - 62 NuclAT_14 - -
- 4974614..4974675 - 62 NuclAT_14 - -
- 4974614..4974675 - 62 NuclAT_14 - -
- 4974614..4974675 - 62 NuclAT_14 - -
- 4974614..4974675 - 62 NuclAT_17 - -
- 4974614..4974675 - 62 NuclAT_17 - -
- 4974614..4974675 - 62 NuclAT_17 - -
- 4974614..4974675 - 62 NuclAT_17 - -
- 4974614..4974675 - 62 NuclAT_20 - -
- 4974614..4974675 - 62 NuclAT_20 - -
- 4974614..4974675 - 62 NuclAT_20 - -
- 4974614..4974675 - 62 NuclAT_20 - -
- 4974614..4974675 - 62 NuclAT_23 - -
- 4974614..4974675 - 62 NuclAT_23 - -
- 4974614..4974675 - 62 NuclAT_23 - -
- 4974614..4974675 - 62 NuclAT_23 - -
- 4974614..4974675 - 62 NuclAT_26 - -
- 4974614..4974675 - 62 NuclAT_26 - -
- 4974614..4974675 - 62 NuclAT_26 - -
- 4974614..4974675 - 62 NuclAT_26 - -
- 4974614..4974675 - 62 NuclAT_29 - -
- 4974614..4974675 - 62 NuclAT_29 - -
- 4974614..4974675 - 62 NuclAT_29 - -
- 4974614..4974675 - 62 NuclAT_29 - -
COG34_RS25805 4974728..4974835 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4975148..4975213 - 66 NuclAT_31 - -
- 4975148..4975213 - 66 NuclAT_31 - -
- 4975148..4975213 - 66 NuclAT_31 - -
- 4975148..4975213 - 66 NuclAT_31 - -
- 4975148..4975213 - 66 NuclAT_34 - -
- 4975148..4975213 - 66 NuclAT_34 - -
- 4975148..4975213 - 66 NuclAT_34 - -
- 4975148..4975213 - 66 NuclAT_34 - -
- 4975148..4975213 - 66 NuclAT_37 - -
- 4975148..4975213 - 66 NuclAT_37 - -
- 4975148..4975213 - 66 NuclAT_37 - -
- 4975148..4975213 - 66 NuclAT_37 - -
- 4975148..4975213 - 66 NuclAT_40 - -
- 4975148..4975213 - 66 NuclAT_40 - -
- 4975148..4975213 - 66 NuclAT_40 - -
- 4975148..4975213 - 66 NuclAT_40 - -
- 4975148..4975213 - 66 NuclAT_43 - -
- 4975148..4975213 - 66 NuclAT_43 - -
- 4975148..4975213 - 66 NuclAT_43 - -
- 4975148..4975213 - 66 NuclAT_43 - -
- 4975148..4975213 - 66 NuclAT_46 - -
- 4975148..4975213 - 66 NuclAT_46 - -
- 4975148..4975213 - 66 NuclAT_46 - -
- 4975148..4975213 - 66 NuclAT_46 - -
- 4975149..4975215 - 67 NuclAT_48 - -
- 4975149..4975215 - 67 NuclAT_48 - -
- 4975149..4975215 - 67 NuclAT_48 - -
- 4975149..4975215 - 67 NuclAT_48 - -
- 4975149..4975215 - 67 NuclAT_51 - -
- 4975149..4975215 - 67 NuclAT_51 - -
- 4975149..4975215 - 67 NuclAT_51 - -
- 4975149..4975215 - 67 NuclAT_51 - -
- 4975149..4975215 - 67 NuclAT_54 - -
- 4975149..4975215 - 67 NuclAT_54 - -
- 4975149..4975215 - 67 NuclAT_54 - -
- 4975149..4975215 - 67 NuclAT_54 - -
- 4975149..4975215 - 67 NuclAT_57 - -
- 4975149..4975215 - 67 NuclAT_57 - -
- 4975149..4975215 - 67 NuclAT_57 - -
- 4975149..4975215 - 67 NuclAT_57 - -
- 4975150..4975213 - 64 NuclAT_13 - -
- 4975150..4975213 - 64 NuclAT_13 - -
- 4975150..4975213 - 64 NuclAT_13 - -
- 4975150..4975213 - 64 NuclAT_13 - -
- 4975150..4975213 - 64 NuclAT_16 - -
- 4975150..4975213 - 64 NuclAT_16 - -
- 4975150..4975213 - 64 NuclAT_16 - -
- 4975150..4975213 - 64 NuclAT_16 - -
- 4975150..4975213 - 64 NuclAT_19 - -
- 4975150..4975213 - 64 NuclAT_19 - -
- 4975150..4975213 - 64 NuclAT_19 - -
- 4975150..4975213 - 64 NuclAT_19 - -
- 4975150..4975213 - 64 NuclAT_22 - -
- 4975150..4975213 - 64 NuclAT_22 - -
- 4975150..4975213 - 64 NuclAT_22 - -
- 4975150..4975213 - 64 NuclAT_22 - -
- 4975150..4975213 - 64 NuclAT_25 - -
- 4975150..4975213 - 64 NuclAT_25 - -
- 4975150..4975213 - 64 NuclAT_25 - -
- 4975150..4975213 - 64 NuclAT_25 - -
- 4975150..4975213 - 64 NuclAT_28 - -
- 4975150..4975213 - 64 NuclAT_28 - -
- 4975150..4975213 - 64 NuclAT_28 - -
- 4975150..4975213 - 64 NuclAT_28 - -
COG34_RS27115 4975263..4975370 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
COG34_RS25815 4975519..4976373 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
COG34_RS25820 4976409..4977218 - 810 WP_001257044.1 invasion regulator SirB1 -
COG34_RS25825 4977222..4977614 - 393 WP_000200392.1 invasion regulator SirB2 -
COG34_RS25830 4977611..4978444 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T87250 WP_000170965.1 NZ_CP024243:4974192-4974299 [Escherichia coli O128:H27]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T87250 NZ_CP024243:4974192-4974299 [Escherichia coli O128:H27]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT87250 NZ_CP024243:c4974145-4974079 [Escherichia coli O128:H27]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References