Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 264895..265159 | Replicon | plasmid unnamed |
| Accession | NZ_CP024238 | ||
| Organism | Escherichia coli O15:H11 strain 90-9272 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | COG31_RS01855 | Protein ID | WP_001387489.1 |
| Coordinates | 264895..265047 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 265099..265159 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| COG31_RS01830 (260161) | 260161..262329 | + | 2169 | WP_099550630.1 | DotA/TraY family protein | - |
| COG31_RS01835 (262400) | 262400..263062 | + | 663 | WP_099550631.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| COG31_RS01840 (263134) | 263134..263343 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| COG31_RS27875 (263735) | 263735..263911 | + | 177 | WP_001054900.1 | hypothetical protein | - |
| COG31_RS28650 (263976) | 263976..264071 | - | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| COG31_RS01850 (264572) | 264572..264823 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| COG31_RS01855 (264895) | 264895..265047 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - (265099) | 265099..265159 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (265099) | 265099..265159 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (265099) | 265099..265159 | + | 61 | NuclAT_2 | - | Antitoxin |
| - (265099) | 265099..265159 | + | 61 | NuclAT_2 | - | Antitoxin |
| COG31_RS01860 (265674) | 265674..266453 | + | 780 | WP_275450201.1 | protein FinQ | - |
| COG31_RS01865 (266760) | 266760..267968 | + | 1209 | WP_001303305.1 | IncI1-type conjugal transfer protein TrbA | - |
| COG31_RS01870 (267987) | 267987..269057 | + | 1071 | WP_099550632.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | etpA / etpB / espC / eltB / eltA / eltA / eltB / csvA | 1..274465 | 274465 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T87176 WP_001387489.1 NZ_CP024238:c265047-264895 [Escherichia coli O15:H11]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T87176 NZ_CP024238:c265047-264895 [Escherichia coli O15:H11]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT87176 NZ_CP024238:265099-265159 [Escherichia coli O15:H11]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|