Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 11985..12249 | Replicon | plasmid unnamed2 |
Accession | NZ_CP024234 | ||
Organism | Escherichia coli O6:H16 strain 2014EL-1346-6 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | CNZ63_RS25680 | Protein ID | WP_001387489.1 |
Coordinates | 12097..12249 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 11985..12047 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- | 7852..7912 | - | 61 | NuclAT_1 | - | - |
- | 7852..7912 | - | 61 | NuclAT_1 | - | - |
- | 7852..7912 | - | 61 | NuclAT_1 | - | - |
- | 7852..7912 | - | 61 | NuclAT_1 | - | - |
CNZ63_RS25660 | 7979..9070 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
CNZ63_RS25665 | 9309..9959 | + | 651 | WP_000993956.1 | IS66 family insertion sequence hypothetical protein | - |
CNZ63_RS25670 | 9959..10306 | + | 348 | WP_099548426.1 | IS66 family insertion sequence element accessory protein TnpB | - |
CNZ63_RS25675 | 10326..11897 | + | 1572 | WP_099548428.1 | IS66 family transposase | - |
- | 11985..12047 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 11985..12047 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 11985..12047 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 11985..12047 | - | 63 | NuclAT_0 | - | Antitoxin |
CNZ63_RS25680 | 12097..12249 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
CNZ63_RS25685 | 12321..12572 | - | 252 | WP_001291965.1 | hypothetical protein | - |
CNZ63_RS25690 | 12872..13168 | + | 297 | WP_001275298.1 | hypothetical protein | - |
CNZ63_RS29095 | 13233..13409 | - | 177 | WP_001054897.1 | hypothetical protein | - |
CNZ63_RS25695 | 13801..14010 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
CNZ63_RS25700 | 14082..14732 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
CNZ63_RS25705 | 14806..16974 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..40223 | 40223 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T87166 WP_001387489.1 NZ_CP024234:12097-12249 [Escherichia coli O6:H16]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T87166 NZ_CP024234:12097-12249 [Escherichia coli O6:H16]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT87166 NZ_CP024234:c12047-11985 [Escherichia coli O6:H16]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|