Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 63508..63772 | Replicon | plasmid unnamed2 |
Accession | NZ_CP024230 | ||
Organism | Escherichia coli O25:NM strain 2014EL-1343-2 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | E6BRV3 |
Locus tag | A3411_RS25965 | Protein ID | WP_001303307.1 |
Coordinates | 63508..63660 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 63710..63772 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A3411_RS25940 | 58762..60931 | + | 2170 | Protein_63 | DotA/TraY family protein | - |
A3411_RS25945 | 61002..61664 | + | 663 | WP_000644795.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
A3411_RS25950 | 61736..61945 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
A3411_RS27010 | 62348..62524 | + | 177 | WP_001054898.1 | hypothetical protein | - |
A3411_RS25955 | 62589..62885 | - | 297 | WP_001275298.1 | hypothetical protein | - |
A3411_RS25960 | 63185..63436 | + | 252 | WP_001291965.1 | hypothetical protein | - |
A3411_RS25965 | 63508..63660 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
- | 63710..63772 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 63710..63772 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 63710..63772 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 63710..63772 | + | 63 | NuclAT_0 | - | Antitoxin |
A3411_RS25970 | 63975..65066 | + | 1092 | WP_001756226.1 | hypothetical protein | - |
- | 65136..65194 | + | 59 | NuclAT_1 | - | - |
- | 65136..65194 | + | 59 | NuclAT_1 | - | - |
- | 65136..65194 | + | 59 | NuclAT_1 | - | - |
- | 65136..65194 | + | 59 | NuclAT_1 | - | - |
A3411_RS25975 | 65374..66582 | + | 1209 | WP_001295719.1 | IncI1-type conjugal transfer protein TrbA | - |
A3411_RS25980 | 66601..67671 | + | 1071 | WP_000151590.1 | IncI1-type conjugal transfer protein TrbB | - |
A3411_RS27015 | 67664..68359 | + | 696 | WP_198406012.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | qnrS1 | - | 1..73915 | 73915 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T87141 WP_001303307.1 NZ_CP024230:c63660-63508 [Escherichia coli O25:NM]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T87141 NZ_CP024230:c63660-63508 [Escherichia coli O25:NM]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT87141 NZ_CP024230:63710-63772 [Escherichia coli O25:NM]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|