Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 75476..75740 | Replicon | plasmid unnamed3 |
Accession | NZ_CP024226 | ||
Organism | Escherichia coli O169:H41 strain 2014EL-1345-2 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | E6BRV3 |
Locus tag | CJV63_RS25990 | Protein ID | WP_001303307.1 |
Coordinates | 75476..75628 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 75678..75740 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CJV63_RS25965 | 70732..72900 | + | 2169 | WP_000698356.1 | DotA/TraY family protein | - |
CJV63_RS25970 | 72971..73633 | + | 663 | WP_000644795.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
CJV63_RS25975 | 73705..73914 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
CJV63_RS27490 | 74316..74492 | + | 177 | WP_001054898.1 | hypothetical protein | - |
CJV63_RS25980 | 74557..74853 | - | 297 | WP_001275298.1 | hypothetical protein | - |
CJV63_RS25985 | 75153..75404 | + | 252 | WP_001291965.1 | hypothetical protein | - |
CJV63_RS25990 | 75476..75628 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
- | 75678..75740 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 75678..75740 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 75678..75740 | + | 63 | NuclAT_0 | - | Antitoxin |
- | 75678..75740 | + | 63 | NuclAT_0 | - | Antitoxin |
CJV63_RS25995 | 75943..77034 | + | 1092 | WP_001756226.1 | hypothetical protein | - |
- | 77104..77162 | + | 59 | NuclAT_1 | - | - |
- | 77104..77162 | + | 59 | NuclAT_1 | - | - |
- | 77104..77162 | + | 59 | NuclAT_1 | - | - |
- | 77104..77162 | + | 59 | NuclAT_1 | - | - |
CJV63_RS26000 | 77342..78550 | + | 1209 | WP_001295719.1 | IncI1-type conjugal transfer protein TrbA | - |
CJV63_RS26005 | 78569..79639 | + | 1071 | WP_000151590.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-15 / qnrS1 | - | 1..85864 | 85864 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T87109 WP_001303307.1 NZ_CP024226:c75628-75476 [Escherichia coli O169:H41]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T87109 NZ_CP024226:c75628-75476 [Escherichia coli O169:H41]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT87109 NZ_CP024226:75678-75740 [Escherichia coli O169:H41]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|