Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2150834..2151054 Replicon chromosome
Accession NZ_CP024155
Organism Escherichia coli strain 14EC047

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag CR540_RS10875 Protein ID WP_000170965.1
Coordinates 2150834..2150941 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2150988..2151054 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CR540_RS10840 2146691..2147524 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
CR540_RS10845 2147521..2147913 + 393 WP_000200378.1 invasion regulator SirB2 -
CR540_RS10850 2147917..2148726 + 810 WP_001257044.1 invasion regulator SirB1 -
CR540_RS10855 2148762..2149616 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CR540_RS10860 2149765..2149872 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2149920..2149986 + 67 NuclAT_50 - -
- 2149920..2149986 + 67 NuclAT_50 - -
- 2149920..2149986 + 67 NuclAT_50 - -
- 2149920..2149986 + 67 NuclAT_50 - -
- 2149920..2149986 + 67 NuclAT_53 - -
- 2149920..2149986 + 67 NuclAT_53 - -
- 2149920..2149986 + 67 NuclAT_53 - -
- 2149920..2149986 + 67 NuclAT_53 - -
- 2149920..2149986 + 67 NuclAT_56 - -
- 2149920..2149986 + 67 NuclAT_56 - -
- 2149920..2149986 + 67 NuclAT_56 - -
- 2149920..2149986 + 67 NuclAT_56 - -
- 2149922..2149985 + 64 NuclAT_16 - -
- 2149922..2149985 + 64 NuclAT_16 - -
- 2149922..2149985 + 64 NuclAT_16 - -
- 2149922..2149985 + 64 NuclAT_16 - -
- 2149922..2149985 + 64 NuclAT_19 - -
- 2149922..2149985 + 64 NuclAT_19 - -
- 2149922..2149985 + 64 NuclAT_19 - -
- 2149922..2149985 + 64 NuclAT_19 - -
- 2149922..2149985 + 64 NuclAT_22 - -
- 2149922..2149985 + 64 NuclAT_22 - -
- 2149922..2149985 + 64 NuclAT_22 - -
- 2149922..2149985 + 64 NuclAT_22 - -
- 2149922..2149985 + 64 NuclAT_25 - -
- 2149922..2149985 + 64 NuclAT_25 - -
- 2149922..2149985 + 64 NuclAT_25 - -
- 2149922..2149985 + 64 NuclAT_25 - -
- 2149922..2149985 + 64 NuclAT_28 - -
- 2149922..2149985 + 64 NuclAT_28 - -
- 2149922..2149985 + 64 NuclAT_28 - -
- 2149922..2149985 + 64 NuclAT_28 - -
- 2149922..2149985 + 64 NuclAT_31 - -
- 2149922..2149985 + 64 NuclAT_31 - -
- 2149922..2149985 + 64 NuclAT_31 - -
- 2149922..2149985 + 64 NuclAT_31 - -
- 2149922..2149987 + 66 NuclAT_34 - -
- 2149922..2149987 + 66 NuclAT_34 - -
- 2149922..2149987 + 66 NuclAT_34 - -
- 2149922..2149987 + 66 NuclAT_34 - -
- 2149922..2149987 + 66 NuclAT_37 - -
- 2149922..2149987 + 66 NuclAT_37 - -
- 2149922..2149987 + 66 NuclAT_37 - -
- 2149922..2149987 + 66 NuclAT_37 - -
- 2149922..2149987 + 66 NuclAT_40 - -
- 2149922..2149987 + 66 NuclAT_40 - -
- 2149922..2149987 + 66 NuclAT_40 - -
- 2149922..2149987 + 66 NuclAT_40 - -
- 2149922..2149987 + 66 NuclAT_43 - -
- 2149922..2149987 + 66 NuclAT_43 - -
- 2149922..2149987 + 66 NuclAT_43 - -
- 2149922..2149987 + 66 NuclAT_43 - -
- 2149922..2149987 + 66 NuclAT_46 - -
- 2149922..2149987 + 66 NuclAT_46 - -
- 2149922..2149987 + 66 NuclAT_46 - -
- 2149922..2149987 + 66 NuclAT_46 - -
- 2149922..2149987 + 66 NuclAT_49 - -
- 2149922..2149987 + 66 NuclAT_49 - -
- 2149922..2149987 + 66 NuclAT_49 - -
- 2149922..2149987 + 66 NuclAT_49 - -
CR540_RS10865 2150300..2150407 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2150455..2150520 + 66 NuclAT_14 - -
- 2150455..2150520 + 66 NuclAT_14 - -
- 2150455..2150520 + 66 NuclAT_14 - -
- 2150455..2150520 + 66 NuclAT_14 - -
- 2150455..2150520 + 66 NuclAT_17 - -
- 2150455..2150520 + 66 NuclAT_17 - -
- 2150455..2150520 + 66 NuclAT_17 - -
- 2150455..2150520 + 66 NuclAT_17 - -
- 2150455..2150520 + 66 NuclAT_20 - -
- 2150455..2150520 + 66 NuclAT_20 - -
- 2150455..2150520 + 66 NuclAT_20 - -
- 2150455..2150520 + 66 NuclAT_20 - -
- 2150455..2150520 + 66 NuclAT_23 - -
- 2150455..2150520 + 66 NuclAT_23 - -
- 2150455..2150520 + 66 NuclAT_23 - -
- 2150455..2150520 + 66 NuclAT_23 - -
- 2150455..2150520 + 66 NuclAT_26 - -
- 2150455..2150520 + 66 NuclAT_26 - -
- 2150455..2150520 + 66 NuclAT_26 - -
- 2150455..2150520 + 66 NuclAT_26 - -
- 2150455..2150520 + 66 NuclAT_29 - -
- 2150455..2150520 + 66 NuclAT_29 - -
- 2150455..2150520 + 66 NuclAT_29 - -
- 2150455..2150520 + 66 NuclAT_29 - -
- 2150455..2150522 + 68 NuclAT_32 - -
- 2150455..2150522 + 68 NuclAT_32 - -
- 2150455..2150522 + 68 NuclAT_32 - -
- 2150455..2150522 + 68 NuclAT_32 - -
- 2150455..2150522 + 68 NuclAT_35 - -
- 2150455..2150522 + 68 NuclAT_35 - -
- 2150455..2150522 + 68 NuclAT_35 - -
- 2150455..2150522 + 68 NuclAT_35 - -
- 2150455..2150522 + 68 NuclAT_38 - -
- 2150455..2150522 + 68 NuclAT_38 - -
- 2150455..2150522 + 68 NuclAT_38 - -
- 2150455..2150522 + 68 NuclAT_38 - -
- 2150455..2150522 + 68 NuclAT_41 - -
- 2150455..2150522 + 68 NuclAT_41 - -
- 2150455..2150522 + 68 NuclAT_41 - -
- 2150455..2150522 + 68 NuclAT_41 - -
- 2150455..2150522 + 68 NuclAT_44 - -
- 2150455..2150522 + 68 NuclAT_44 - -
- 2150455..2150522 + 68 NuclAT_44 - -
- 2150455..2150522 + 68 NuclAT_44 - -
- 2150455..2150522 + 68 NuclAT_47 - -
- 2150455..2150522 + 68 NuclAT_47 - -
- 2150455..2150522 + 68 NuclAT_47 - -
- 2150455..2150522 + 68 NuclAT_47 - -
- 2150456..2150521 + 66 NuclAT_51 - -
- 2150456..2150521 + 66 NuclAT_51 - -
- 2150456..2150521 + 66 NuclAT_51 - -
- 2150456..2150521 + 66 NuclAT_51 - -
- 2150456..2150521 + 66 NuclAT_54 - -
- 2150456..2150521 + 66 NuclAT_54 - -
- 2150456..2150521 + 66 NuclAT_54 - -
- 2150456..2150521 + 66 NuclAT_54 - -
- 2150456..2150521 + 66 NuclAT_57 - -
- 2150456..2150521 + 66 NuclAT_57 - -
- 2150456..2150521 + 66 NuclAT_57 - -
- 2150456..2150521 + 66 NuclAT_57 - -
CR540_RS10875 2150834..2150941 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2150988..2151054 + 67 - - Antitoxin
CR540_RS10880 2151346..2152446 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
CR540_RS10885 2152716..2152946 + 231 WP_001146442.1 putative cation transport regulator ChaB -
CR540_RS10890 2153104..2153799 + 696 Protein_2092 glutathione-specific gamma-glutamylcyclotransferase -
CR540_RS10895 2153843..2154196 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
CR540_RS10900 2154381..2155775 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T86995 WP_000170965.1 NZ_CP024155:c2150941-2150834 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T86995 NZ_CP024155:c2150941-2150834 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT86995 NZ_CP024155:2150988-2151054 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References