Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 28013..28277 | Replicon | plasmid p14EC033e |
Accession | NZ_CP024152 | ||
Organism | Escherichia coli strain 14EC033 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | CR539_RS26205 | Protein ID | WP_001331364.1 |
Coordinates | 28013..28165 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 28220..28277 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CR539_RS26185 | 23347..25515 | + | 2169 | WP_000698366.1 | DotA/TraY family protein | - |
CR539_RS26190 | 25580..26242 | + | 663 | WP_000644792.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
CR539_RS26195 | 26314..26523 | - | 210 | WP_000062602.1 | HEAT repeat domain-containing protein | - |
CR539_RS28325 | 26855..27031 | + | 177 | WP_001054900.1 | hypothetical protein | - |
CR539_RS26200 | 27690..27941 | + | 252 | WP_001291964.1 | hypothetical protein | - |
CR539_RS26205 | 28013..28165 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
- | 28220..28277 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 28220..28277 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 28220..28277 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 28220..28277 | + | 58 | NuclAT_0 | - | Antitoxin |
CR539_RS26210 | 28438..29424 | + | 987 | WP_001257838.1 | hypothetical protein | - |
CR539_RS26215 | 29642..30850 | + | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
CR539_RS26220 | 30869..31939 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..87351 | 87351 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T86979 WP_001331364.1 NZ_CP024152:c28165-28013 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T86979 NZ_CP024152:c28165-28013 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT86979 NZ_CP024152:28220-28277 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|