Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 78025..78451 | Replicon | plasmid p14EC033d |
Accession | NZ_CP024151 | ||
Organism | Escherichia coli strain 14EC033 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CR539_RS25880 | Protein ID | WP_001312861.1 |
Coordinates | 78025..78183 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 78227..78451 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CR539_RS25835 | 73073..73300 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
CR539_RS25840 | 73395..74081 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
CR539_RS25845 | 74272..74655 | - | 384 | WP_000124981.1 | relaxosome protein TraM | - |
CR539_RS25850 | 74932..75579 | + | 648 | WP_148726238.1 | transglycosylase SLT domain-containing protein | - |
CR539_RS25855 | 75876..76697 | - | 822 | WP_033804334.1 | DUF945 domain-containing protein | - |
CR539_RS25860 | 76816..77103 | - | 288 | WP_000107535.1 | hypothetical protein | - |
CR539_RS28315 | 77128..77334 | - | 207 | WP_033804333.1 | hypothetical protein | - |
CR539_RS25880 | 78025..78183 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 78227..78451 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 78227..78451 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 78227..78451 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 78227..78451 | - | 225 | NuclAT_0 | - | Antitoxin |
CR539_RS28130 | 78263..78451 | + | 189 | WP_063073474.1 | hypothetical protein | - |
CR539_RS25885 | 78463..79182 | - | 720 | WP_001276240.1 | plasmid SOS inhibition protein A | - |
CR539_RS25890 | 79179..79613 | - | 435 | WP_000845907.1 | conjugation system SOS inhibitor PsiB | - |
CR539_RS25895 | 79668..81626 | - | 1959 | WP_063072993.1 | ParB/RepB/Spo0J family partition protein | - |
CR539_RS25900 | 81691..81924 | - | 234 | WP_000006030.1 | DUF905 family protein | - |
CR539_RS25905 | 81986..82438 | - | 453 | WP_000290842.1 | single-stranded DNA-binding protein | - |
CR539_RS28320 | 82464..82670 | - | 207 | WP_000275853.1 | hypothetical protein | - |
CR539_RS25930 | 83081..83305 | - | 225 | WP_016238251.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..97858 | 97858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T86975 WP_001312861.1 NZ_CP024151:c78183-78025 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T86975 NZ_CP024151:c78183-78025 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT86975 NZ_CP024151:c78451-78227 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGACAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGACAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|