Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2436746..2436971 | Replicon | chromosome |
Accession | NZ_CP024138 | ||
Organism | Escherichia coli strain 14EC020 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CR537_RS12565 | Protein ID | WP_000813254.1 |
Coordinates | 2436816..2436971 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2436746..2436804 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CR537_RS12530 | 2431914..2432321 | - | 408 | WP_000381212.1 | helix-turn-helix domain-containing protein | - |
CR537_RS12535 | 2432402..2432629 | + | 228 | WP_000921596.1 | transcriptional regulator | - |
CR537_RS12540 | 2432613..2433134 | + | 522 | WP_000705360.1 | hypothetical protein | - |
CR537_RS12545 | 2433115..2434080 | + | 966 | WP_000054495.1 | hypothetical protein | - |
CR537_RS12550 | 2434121..2434522 | + | 402 | WP_001151252.1 | DUF977 family protein | - |
CR537_RS12555 | 2435056..2436081 | + | 1026 | WP_000547812.1 | RelA/SpoT domain-containing protein | - |
- | 2436746..2436804 | - | 59 | - | - | Antitoxin |
CR537_RS12565 | 2436816..2436971 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
CR537_RS12570 | 2437188..2437439 | + | 252 | WP_000980999.1 | hypothetical protein | - |
CR537_RS12575 | 2437506..2437784 | + | 279 | WP_032297225.1 | hypothetical protein | - |
CR537_RS12580 | 2437786..2438835 | + | 1050 | WP_001696469.1 | DUF968 domain-containing protein | - |
CR537_RS12585 | 2438849..2439601 | + | 753 | WP_001047132.1 | antitermination protein | - |
CR537_RS12590 | 2439776..2439978 | - | 203 | Protein_2302 | cold shock-like protein CspF | - |
CR537_RS12595 | 2440277..2440492 | + | 216 | WP_000066485.1 | cold shock-like protein CspB | - |
CR537_RS27440 | 2440856..2441026 | - | 171 | WP_001405948.1 | putative zinc-binding protein YnfU | - |
CR537_RS12605 | 2441246..2441461 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
CR537_RS12610 | 2441466..2441777 | + | 312 | WP_000189916.1 | YdfR family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2421928..2478082 | 56154 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T86885 WP_000813254.1 NZ_CP024138:2436816-2436971 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T86885 NZ_CP024138:2436816-2436971 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT86885 NZ_CP024138:c2436804-2436746 [Escherichia coli]
CCTTGCCTTCCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTCCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|