Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2015710..2015935 | Replicon | chromosome |
Accession | NZ_CP024138 | ||
Organism | Escherichia coli strain 14EC020 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CR537_RS10170 | Protein ID | WP_000813254.1 |
Coordinates | 2015780..2015935 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2015710..2015768 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CR537_RS10125 | 2011088..2011306 | - | 219 | WP_001171942.1 | hypothetical protein | - |
CR537_RS10135 | 2011466..2011621 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
CR537_RS10140 | 2011919..2012338 | - | 420 | WP_000233320.1 | helix-turn-helix domain-containing protein | - |
CR537_RS10145 | 2012418..2012672 | + | 255 | WP_001072337.1 | hypothetical protein | - |
CR537_RS10150 | 2012669..2013094 | + | 426 | WP_000693853.1 | Rha family transcriptional regulator | - |
CR537_RS10155 | 2013166..2014236 | + | 1071 | WP_021530548.1 | hypothetical protein | - |
CR537_RS10160 | 2014277..2014702 | + | 426 | WP_001151253.1 | DUF977 family protein | - |
CR537_RS10165 | 2014877..2015542 | + | 666 | WP_000150294.1 | epoxyqueuosine reductase QueH | - |
- | 2015710..2015768 | - | 59 | - | - | Antitoxin |
CR537_RS10170 | 2015780..2015935 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
CR537_RS10175 | 2016103..2016381 | + | 279 | WP_024193993.1 | hypothetical protein | - |
CR537_RS10180 | 2016383..2017441 | + | 1059 | WP_101980497.1 | DUF968 domain-containing protein | - |
CR537_RS10185 | 2017442..2017807 | + | 366 | WP_000140004.1 | RusA family crossover junction endodeoxyribonuclease | - |
CR537_RS10190 | 2017804..2018493 | + | 690 | WP_101980498.1 | antiterminator | - |
CR537_RS10220 | 2019306..2019521 | + | 216 | WP_000839572.1 | class II holin family protein | - |
CR537_RS10225 | 2019526..2019876 | + | 351 | WP_059333431.1 | YdfR family protein | - |
CR537_RS10230 | 2019940..2020473 | + | 534 | WP_021568386.1 | lysozyme | - |
CR537_RS10240 | 2020690..2020872 | + | 183 | WP_077575695.1 | Rz1 family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ybtP / ybtQ / ybtX / ybtS | 1997269..2047677 | 50408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T86875 WP_000813254.1 NZ_CP024138:2015780-2015935 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T86875 NZ_CP024138:2015780-2015935 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT86875 NZ_CP024138:c2015768-2015710 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|