Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 274046..274268 | Replicon | chromosome |
Accession | NZ_CP024138 | ||
Organism | Escherichia coli strain 14EC020 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | CR537_RS26975 | Protein ID | WP_001295224.1 |
Coordinates | 274161..274268 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 274046..274104 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CR537_RS01395 | 269931..270935 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
CR537_RS01400 | 270965..272236 | - | 1272 | WP_001318103.1 | amino acid permease | - |
CR537_RS26965 | 272712..272819 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
CR537_RS01420 | 273195..273302 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
CR537_RS26970 | 273678..273785 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 274046..274104 | - | 59 | - | - | Antitoxin |
CR537_RS26975 | 274161..274268 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
CR537_RS01440 | 274355..276034 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
CR537_RS01445 | 276031..276222 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
CR537_RS01450 | 276219..277790 | - | 1572 | WP_001204944.1 | cellulose biosynthesis protein BcsE | - |
CR537_RS01455 | 278063..278251 | + | 189 | WP_001063315.1 | YhjR family protein | - |
CR537_RS01460 | 278263..279015 | + | 753 | Protein_265 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T86868 WP_001295224.1 NZ_CP024138:274161-274268 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T86868 NZ_CP024138:274161-274268 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT86868 NZ_CP024138:c274104-274046 [Escherichia coli]
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|