Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 272597..272819 | Replicon | chromosome |
| Accession | NZ_CP024138 | ||
| Organism | Escherichia coli strain 14EC020 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | CR537_RS26965 | Protein ID | WP_000170738.1 |
| Coordinates | 272712..272819 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 272597..272663 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CR537_RS01385 | 268038..268940 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| CR537_RS01390 | 268951..269934 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| CR537_RS01395 | 269931..270935 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| CR537_RS01400 | 270965..272236 | - | 1272 | WP_001318103.1 | amino acid permease | - |
| - | 272597..272663 | - | 67 | - | - | Antitoxin |
| CR537_RS26965 | 272712..272819 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| CR537_RS01420 | 273195..273302 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| CR537_RS26970 | 273678..273785 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| CR537_RS26975 | 274161..274268 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| CR537_RS01440 | 274355..276034 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
| CR537_RS01445 | 276031..276222 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| CR537_RS01450 | 276219..277790 | - | 1572 | WP_001204944.1 | cellulose biosynthesis protein BcsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T86864 WP_000170738.1 NZ_CP024138:272712-272819 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T86864 NZ_CP024138:272712-272819 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATAGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATAGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT86864 NZ_CP024138:c272663-272597 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|