Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 64323..64592 | Replicon | plasmid p14EC007b |
Accession | NZ_CP024133 | ||
Organism | Escherichia coli strain 14EC007 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CR535_RS27860 | Protein ID | WP_001312861.1 |
Coordinates | 64434..64592 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 64323..64388 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CR535_RS27830 | 60116..60643 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
CR535_RS27835 | 60699..60932 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
CR535_RS27840 | 60991..62949 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
CR535_RS27845 | 63004..63438 | + | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
CR535_RS27850 | 63435..64154 | + | 720 | WP_001276228.1 | plasmid SOS inhibition protein A | - |
CR535_RS27855 | 64166..64354 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 64166..64390 | + | 225 | NuclAT_0 | - | - |
- | 64166..64390 | + | 225 | NuclAT_0 | - | - |
- | 64166..64390 | + | 225 | NuclAT_0 | - | - |
- | 64166..64390 | + | 225 | NuclAT_0 | - | - |
- | 64323..64388 | + | 66 | - | - | Antitoxin |
CR535_RS27860 | 64434..64592 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CR535_RS27880 | 65514..65801 | + | 288 | WP_000107535.1 | hypothetical protein | - |
CR535_RS27885 | 65921..66742 | + | 822 | WP_001241365.1 | DUF945 domain-containing protein | - |
CR535_RS27890 | 67039..67641 | - | 603 | WP_000243705.1 | transglycosylase SLT domain-containing protein | - |
CR535_RS27895 | 67962..68345 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
CR535_RS27900 | 68532..69221 | + | 690 | WP_000283379.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD / sul3 / blaTEM-1B / qnrS1 / dfrA12 / aadA2 / tet(A) | stcE / exeE / exeG | 1..190293 | 190293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T86831 WP_001312861.1 NZ_CP024133:64434-64592 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T86831 NZ_CP024133:64434-64592 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT86831 NZ_CP024133:64323-64388 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|