Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 93221..93647 | Replicon | plasmid p14EC001b |
Accession | NZ_CP024129 | ||
Organism | Escherichia coli strain 14EC001 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CR534_RS27980 | Protein ID | WP_001312861.1 |
Coordinates | 93221..93379 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 93423..93647 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CR534_RS27940 | 88592..89281 | - | 690 | WP_000283379.1 | conjugal transfer transcriptional regulator TraJ | - |
CR534_RS27945 | 89468..89851 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
CR534_RS27950 | 90172..90774 | + | 603 | WP_000243705.1 | transglycosylase SLT domain-containing protein | - |
CR534_RS27955 | 91071..91892 | - | 822 | WP_001241365.1 | DUF945 domain-containing protein | - |
CR534_RS27960 | 92012..92299 | - | 288 | WP_000107535.1 | hypothetical protein | - |
CR534_RS29425 | 92324..92530 | - | 207 | WP_033804333.1 | hypothetical protein | - |
CR534_RS29585 | 92771..92926 | - | 156 | WP_213080977.1 | hypothetical protein | - |
CR534_RS27980 | 93221..93379 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 93423..93647 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 93423..93647 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 93423..93647 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 93423..93647 | - | 225 | NuclAT_0 | - | Antitoxin |
CR534_RS29175 | 93459..93647 | + | 189 | WP_001299721.1 | hypothetical protein | - |
CR534_RS27985 | 93659..94378 | - | 720 | WP_001276240.1 | plasmid SOS inhibition protein A | - |
CR534_RS27990 | 94375..94809 | - | 435 | WP_101981708.1 | conjugation system SOS inhibitor PsiB | - |
CR534_RS27995 | 94864..96822 | - | 1959 | WP_063072993.1 | ParB/RepB/Spo0J family partition protein | - |
CR534_RS28000 | 96887..97120 | - | 234 | WP_000006030.1 | DUF905 family protein | - |
CR534_RS28005 | 97182..97634 | - | 453 | WP_000290842.1 | single-stranded DNA-binding protein | - |
CR534_RS28025 | 98107..98364 | - | 258 | WP_072193410.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) | stcE / exeE / exeG / stcE / stcE / stcE / stcE / exeE / exeG | 1..123884 | 123884 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T86803 WP_001312861.1 NZ_CP024129:c93379-93221 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T86803 NZ_CP024129:c93379-93221 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT86803 NZ_CP024129:c93647-93423 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|