Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 850581..850743 | Replicon | chromosome |
Accession | NZ_CP023966 | ||
Organism | Staphylococcus capitis strain FDAARGOS_378 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A507SQ11 |
Locus tag | CRN29_RS04215 | Protein ID | WP_030063529.1 |
Coordinates | 850581..850685 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 850713..850743 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CRN29_RS04205 | 846513..849452 | + | 2940 | WP_049326519.1 | AAA family ATPase | - |
CRN29_RS04210 | 849449..850390 | + | 942 | WP_002434737.1 | 3'-5' exoribonuclease YhaM | - |
CRN29_RS04215 | 850581..850685 | + | 105 | WP_030063529.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 850713..850743 | + | 31 | - | - | Antitoxin |
CRN29_RS04220 | 850840..851841 | - | 1002 | WP_023350053.1 | peptidylprolyl isomerase | - |
CRN29_RS04225 | 852043..852612 | - | 570 | WP_002434864.1 | DUF3267 domain-containing protein | - |
CRN29_RS04230 | 852804..853175 | - | 372 | WP_002434824.1 | YtxH domain-containing protein | - |
CRN29_RS04235 | 853253..853678 | - | 426 | WP_002434751.1 | HIT family protein | - |
CRN29_RS04240 | 853811..854551 | + | 741 | WP_002453567.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3963.74 Da Isoelectric Point: 10.7588
>T86541 WP_030063529.1 NZ_CP023966:850581-850685 [Staphylococcus capitis]
MLFDIFVHIMATATSGCIVALFAHWLRTRNDKRK
MLFDIFVHIMATATSGCIVALFAHWLRTRNDKRK
Download Length: 105 bp
>T86541 NZ_CP023966:850581-850685 [Staphylococcus capitis]
ATGTTATTTGATATCTTTGTACACATCATGGCCACGGCAACCAGTGGTTGTATCGTTGCTTTATTCGCGCATTGGCTACG
CACTCGCAACGATAAACGTAAATAG
ATGTTATTTGATATCTTTGTACACATCATGGCCACGGCAACCAGTGGTTGTATCGTTGCTTTATTCGCGCATTGGCTACG
CACTCGCAACGATAAACGTAAATAG
Antitoxin
Download Length: 31 bp
>AT86541 NZ_CP023966:850713-850743 [Staphylococcus capitis]
AAATCCCCTCACTACTGCCATAGTGAGGGGA
AAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|