Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 628267..628488 Replicon chromosome
Accession NZ_CP023960
Organism Escherichia coli strain FDAARGOS_448

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag CRN68_RS04520 Protein ID WP_000176713.1
Coordinates 628267..628374 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 628422..628488 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CRN68_RS04485 623401..624483 + 1083 WP_000804726.1 peptide chain release factor 1 -
CRN68_RS04490 624483..625316 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
CRN68_RS04495 625313..625705 + 393 WP_000200377.1 invasion regulator SirB2 -
CRN68_RS04500 625709..626518 + 810 WP_001257044.1 invasion regulator SirB1 -
CRN68_RS04505 626554..627408 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CRN68_RS04515 627603..628061 + 459 WP_000526135.1 IS200/IS605 family transposase -
CRN68_RS04520 628267..628374 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 628422..628488 + 67 NuclAT_21 - Antitoxin
- 628422..628488 + 67 NuclAT_21 - Antitoxin
- 628422..628488 + 67 NuclAT_21 - Antitoxin
- 628422..628488 + 67 NuclAT_21 - Antitoxin
- 628422..628488 + 67 NuclAT_26 - Antitoxin
- 628422..628488 + 67 NuclAT_26 - Antitoxin
- 628422..628488 + 67 NuclAT_26 - Antitoxin
- 628422..628488 + 67 NuclAT_26 - Antitoxin
- 628422..628488 + 67 NuclAT_31 - Antitoxin
- 628422..628488 + 67 NuclAT_31 - Antitoxin
- 628422..628488 + 67 NuclAT_31 - Antitoxin
- 628422..628488 + 67 NuclAT_31 - Antitoxin
- 628422..628488 + 67 NuclAT_36 - Antitoxin
- 628422..628488 + 67 NuclAT_36 - Antitoxin
- 628422..628488 + 67 NuclAT_36 - Antitoxin
- 628422..628488 + 67 NuclAT_36 - Antitoxin
- 628422..628488 + 67 NuclAT_38 - Antitoxin
- 628422..628488 + 67 NuclAT_38 - Antitoxin
- 628422..628488 + 67 NuclAT_38 - Antitoxin
- 628422..628488 + 67 NuclAT_38 - Antitoxin
- 628422..628488 + 67 NuclAT_43 - Antitoxin
- 628422..628488 + 67 NuclAT_43 - Antitoxin
- 628422..628488 + 67 NuclAT_43 - Antitoxin
- 628422..628488 + 67 NuclAT_43 - Antitoxin
- 628424..628487 + 64 NuclAT_46 - -
- 628424..628487 + 64 NuclAT_46 - -
- 628424..628487 + 64 NuclAT_46 - -
- 628424..628487 + 64 NuclAT_46 - -
- 628424..628487 + 64 NuclAT_48 - -
- 628424..628487 + 64 NuclAT_48 - -
- 628424..628487 + 64 NuclAT_48 - -
- 628424..628487 + 64 NuclAT_48 - -
CRN68_RS04530 628802..628909 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 628962..629023 + 62 NuclAT_45 - -
- 628962..629023 + 62 NuclAT_45 - -
- 628962..629023 + 62 NuclAT_45 - -
- 628962..629023 + 62 NuclAT_45 - -
- 628962..629023 + 62 NuclAT_47 - -
- 628962..629023 + 62 NuclAT_47 - -
- 628962..629023 + 62 NuclAT_47 - -
- 628962..629023 + 62 NuclAT_47 - -
- 628962..629024 + 63 NuclAT_22 - -
- 628962..629024 + 63 NuclAT_22 - -
- 628962..629024 + 63 NuclAT_22 - -
- 628962..629024 + 63 NuclAT_22 - -
- 628962..629024 + 63 NuclAT_27 - -
- 628962..629024 + 63 NuclAT_27 - -
- 628962..629024 + 63 NuclAT_27 - -
- 628962..629024 + 63 NuclAT_27 - -
- 628962..629024 + 63 NuclAT_32 - -
- 628962..629024 + 63 NuclAT_32 - -
- 628962..629024 + 63 NuclAT_32 - -
- 628962..629024 + 63 NuclAT_32 - -
- 628962..629024 + 63 NuclAT_37 - -
- 628962..629024 + 63 NuclAT_37 - -
- 628962..629024 + 63 NuclAT_37 - -
- 628962..629024 + 63 NuclAT_37 - -
- 628962..629024 + 63 NuclAT_39 - -
- 628962..629024 + 63 NuclAT_39 - -
- 628962..629024 + 63 NuclAT_39 - -
- 628962..629024 + 63 NuclAT_39 - -
- 628962..629024 + 63 NuclAT_44 - -
- 628962..629024 + 63 NuclAT_44 - -
- 628962..629024 + 63 NuclAT_44 - -
- 628962..629024 + 63 NuclAT_44 - -
CRN68_RS04540 629315..630415 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
CRN68_RS04545 630685..630915 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CRN68_RS04550 631073..631768 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
CRN68_RS04555 631812..632165 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 627603..628061 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T86455 WP_000176713.1 NZ_CP023960:c628374-628267 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T86455 NZ_CP023960:c628374-628267 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT86455 NZ_CP023960:628422-628488 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References