Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 30058..30327 | Replicon | plasmid unnamed |
Accession | NZ_CP023918 | ||
Organism | Klebsiella pneumoniae strain FDAARGOS_439 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CRN23_RS28765 | Protein ID | WP_001312861.1 |
Coordinates | 30169..30327 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 30058..30123 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CRN23_RS28725 | 25347..25540 | + | 194 | Protein_30 | hypothetical protein | - |
CRN23_RS28735 | 25768..26295 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
CRN23_RS28740 | 26353..26586 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
CRN23_RS28745 | 26647..28670 | + | 2024 | Protein_33 | ParB/RepB/Spo0J family partition protein | - |
CRN23_RS28750 | 28739..29173 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
CRN23_RS28755 | 29170..29889 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 29901..30125 | + | 225 | NuclAT_0 | - | - |
- | 29901..30125 | + | 225 | NuclAT_0 | - | - |
- | 29901..30125 | + | 225 | NuclAT_0 | - | - |
- | 29901..30125 | + | 225 | NuclAT_0 | - | - |
- | 30058..30123 | + | 66 | - | - | Antitoxin |
CRN23_RS28765 | 30169..30327 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CRN23_RS28775 | 30823..31016 | + | 194 | Protein_37 | hypothetical protein | - |
CRN23_RS28785 | 31242..31538 | + | 297 | WP_001272251.1 | hypothetical protein | - |
CRN23_RS28790 | 31649..32470 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
CRN23_RS28795 | 32767..33369 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
CRN23_RS28805 | 33692..34075 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
CRN23_RS28810 | 34269..34940 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
CRN23_RS28815 | 35077..35304 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-15 / dfrA17 / aadA5 / qacE / sul1 / mph(A) / erm(B) / qnrS1 | - | 1..106914 | 106914 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T86375 WP_001312861.1 NZ_CP023918:30169-30327 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T86375 NZ_CP023918:30169-30327 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT86375 NZ_CP023918:30058-30123 [Klebsiella pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|