Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 39209..39635 | Replicon | plasmid p4_0.1 |
Accession | NZ_CP023850 | ||
Organism | Escherichia coli strain 4/0 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CRT34_RS26470 | Protein ID | WP_001312861.1 |
Coordinates | 39209..39367 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 39411..39635 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CRT34_RS26420 | 34247..34474 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
CRT34_RS26425 | 34568..35254 | - | 687 | WP_000332487.1 | PAS domain-containing protein | - |
CRT34_RS26430 | 35448..35831 | - | 384 | WP_001151564.1 | relaxosome protein TraM | - |
CRT34_RS26435 | 36117..36764 | + | 648 | WP_000614282.1 | transglycosylase SLT domain-containing protein | - |
CRT34_RS26440 | 37061..37882 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
CRT34_RS26445 | 38003..38290 | - | 288 | WP_000107537.1 | hypothetical protein | - |
CRT34_RS26470 | 39209..39367 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 39411..39635 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 39411..39635 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 39411..39635 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 39411..39635 | - | 225 | NuclAT_0 | - | Antitoxin |
CRT34_RS28045 | 39447..39635 | + | 189 | WP_001299721.1 | hypothetical protein | - |
CRT34_RS26475 | 39647..40366 | - | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
CRT34_RS26480 | 40363..40797 | - | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
CRT34_RS26485 | 40852..42810 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
CRT34_RS26490 | 42869..43102 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
CRT34_RS26495 | 43158..43685 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / aac(3)-IIa / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / tet(A) | - | 1..138672 | 138672 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T86260 WP_001312861.1 NZ_CP023850:c39367-39209 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T86260 NZ_CP023850:c39367-39209 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT86260 NZ_CP023850:c39635-39411 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|