Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1383262..1383483 Replicon chromosome
Accession NZ_CP023849
Organism Escherichia coli strain 4/0

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag CRT34_RS06960 Protein ID WP_001531632.1
Coordinates 1383262..1383369 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1383417..1383483 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CRT34_RS06935 1379106..1380188 + 1083 WP_000804726.1 peptide chain release factor 1 -
CRT34_RS06940 1380188..1381021 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
CRT34_RS06945 1381018..1381410 + 393 WP_000200375.1 invasion regulator SirB2 -
CRT34_RS06950 1381414..1382223 + 810 WP_001257044.1 invasion regulator SirB1 -
CRT34_RS06955 1382259..1383113 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CRT34_RS06960 1383262..1383369 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1383417..1383483 + 67 NuclAT_10 - Antitoxin
- 1383417..1383483 + 67 NuclAT_10 - Antitoxin
- 1383417..1383483 + 67 NuclAT_10 - Antitoxin
- 1383417..1383483 + 67 NuclAT_10 - Antitoxin
- 1383417..1383483 + 67 NuclAT_5 - Antitoxin
- 1383417..1383483 + 67 NuclAT_5 - Antitoxin
- 1383417..1383483 + 67 NuclAT_5 - Antitoxin
- 1383417..1383483 + 67 NuclAT_5 - Antitoxin
- 1383417..1383483 + 67 NuclAT_6 - Antitoxin
- 1383417..1383483 + 67 NuclAT_6 - Antitoxin
- 1383417..1383483 + 67 NuclAT_6 - Antitoxin
- 1383417..1383483 + 67 NuclAT_6 - Antitoxin
- 1383417..1383483 + 67 NuclAT_7 - Antitoxin
- 1383417..1383483 + 67 NuclAT_7 - Antitoxin
- 1383417..1383483 + 67 NuclAT_7 - Antitoxin
- 1383417..1383483 + 67 NuclAT_7 - Antitoxin
- 1383417..1383483 + 67 NuclAT_8 - Antitoxin
- 1383417..1383483 + 67 NuclAT_8 - Antitoxin
- 1383417..1383483 + 67 NuclAT_8 - Antitoxin
- 1383417..1383483 + 67 NuclAT_8 - Antitoxin
- 1383417..1383483 + 67 NuclAT_9 - Antitoxin
- 1383417..1383483 + 67 NuclAT_9 - Antitoxin
- 1383417..1383483 + 67 NuclAT_9 - Antitoxin
- 1383417..1383483 + 67 NuclAT_9 - Antitoxin
- 1383419..1383482 + 64 NuclAT_12 - -
- 1383419..1383482 + 64 NuclAT_12 - -
- 1383419..1383482 + 64 NuclAT_12 - -
- 1383419..1383482 + 64 NuclAT_12 - -
- 1383419..1383482 + 64 NuclAT_13 - -
- 1383419..1383482 + 64 NuclAT_13 - -
- 1383419..1383482 + 64 NuclAT_13 - -
- 1383419..1383482 + 64 NuclAT_13 - -
- 1383419..1383482 + 64 NuclAT_14 - -
- 1383419..1383482 + 64 NuclAT_14 - -
- 1383419..1383482 + 64 NuclAT_14 - -
- 1383419..1383482 + 64 NuclAT_14 - -
- 1383419..1383482 + 64 NuclAT_15 - -
- 1383419..1383482 + 64 NuclAT_15 - -
- 1383419..1383482 + 64 NuclAT_15 - -
- 1383419..1383482 + 64 NuclAT_15 - -
- 1383419..1383482 + 64 NuclAT_16 - -
- 1383419..1383482 + 64 NuclAT_16 - -
- 1383419..1383482 + 64 NuclAT_16 - -
- 1383419..1383482 + 64 NuclAT_16 - -
- 1383419..1383482 + 64 NuclAT_17 - -
- 1383419..1383482 + 64 NuclAT_17 - -
- 1383419..1383482 + 64 NuclAT_17 - -
- 1383419..1383482 + 64 NuclAT_17 - -
- 1383419..1383484 + 66 NuclAT_18 - -
- 1383419..1383484 + 66 NuclAT_18 - -
- 1383419..1383484 + 66 NuclAT_18 - -
- 1383419..1383484 + 66 NuclAT_18 - -
- 1383419..1383484 + 66 NuclAT_19 - -
- 1383419..1383484 + 66 NuclAT_19 - -
- 1383419..1383484 + 66 NuclAT_19 - -
- 1383419..1383484 + 66 NuclAT_19 - -
- 1383419..1383484 + 66 NuclAT_20 - -
- 1383419..1383484 + 66 NuclAT_20 - -
- 1383419..1383484 + 66 NuclAT_20 - -
- 1383419..1383484 + 66 NuclAT_20 - -
- 1383419..1383484 + 66 NuclAT_21 - -
- 1383419..1383484 + 66 NuclAT_21 - -
- 1383419..1383484 + 66 NuclAT_21 - -
- 1383419..1383484 + 66 NuclAT_21 - -
- 1383419..1383484 + 66 NuclAT_22 - -
- 1383419..1383484 + 66 NuclAT_22 - -
- 1383419..1383484 + 66 NuclAT_22 - -
- 1383419..1383484 + 66 NuclAT_22 - -
- 1383419..1383484 + 66 NuclAT_23 - -
- 1383419..1383484 + 66 NuclAT_23 - -
- 1383419..1383484 + 66 NuclAT_23 - -
- 1383419..1383484 + 66 NuclAT_23 - -
CRT34_RS06965 1383774..1384874 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
CRT34_RS06970 1385144..1385383 + 240 WP_000120702.1 putative cation transport regulator ChaB -
CRT34_RS06975 1385532..1386227 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
CRT34_RS06980 1386271..1386624 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
CRT34_RS06985 1386809..1388203 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T86233 WP_001531632.1 NZ_CP023849:c1383369-1383262 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T86233 NZ_CP023849:c1383369-1383262 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT86233 NZ_CP023849:1383417-1383483 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References