Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1387790..1388011 Replicon chromosome
Accession NZ_CP023820
Organism Escherichia coli strain 7/2

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag CRT46_RS06690 Protein ID WP_000176713.1
Coordinates 1387790..1387897 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1387945..1388011 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CRT46_RS06655 1382924..1384006 + 1083 WP_000804726.1 peptide chain release factor 1 -
CRT46_RS06660 1384006..1384839 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
CRT46_RS06665 1384836..1385228 + 393 WP_000200377.1 invasion regulator SirB2 -
CRT46_RS06670 1385232..1386041 + 810 WP_001257044.1 invasion regulator SirB1 -
CRT46_RS06675 1386077..1386931 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CRT46_RS06685 1387126..1387584 + 459 WP_000526135.1 IS200/IS605 family transposase -
CRT46_RS06690 1387790..1387897 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1387945..1388011 + 67 NuclAT_21 - Antitoxin
- 1387945..1388011 + 67 NuclAT_21 - Antitoxin
- 1387945..1388011 + 67 NuclAT_21 - Antitoxin
- 1387945..1388011 + 67 NuclAT_21 - Antitoxin
- 1387945..1388011 + 67 NuclAT_26 - Antitoxin
- 1387945..1388011 + 67 NuclAT_26 - Antitoxin
- 1387945..1388011 + 67 NuclAT_26 - Antitoxin
- 1387945..1388011 + 67 NuclAT_26 - Antitoxin
- 1387945..1388011 + 67 NuclAT_31 - Antitoxin
- 1387945..1388011 + 67 NuclAT_31 - Antitoxin
- 1387945..1388011 + 67 NuclAT_31 - Antitoxin
- 1387945..1388011 + 67 NuclAT_31 - Antitoxin
- 1387945..1388011 + 67 NuclAT_36 - Antitoxin
- 1387945..1388011 + 67 NuclAT_36 - Antitoxin
- 1387945..1388011 + 67 NuclAT_36 - Antitoxin
- 1387945..1388011 + 67 NuclAT_36 - Antitoxin
- 1387945..1388011 + 67 NuclAT_38 - Antitoxin
- 1387945..1388011 + 67 NuclAT_38 - Antitoxin
- 1387945..1388011 + 67 NuclAT_38 - Antitoxin
- 1387945..1388011 + 67 NuclAT_38 - Antitoxin
- 1387945..1388011 + 67 NuclAT_43 - Antitoxin
- 1387945..1388011 + 67 NuclAT_43 - Antitoxin
- 1387945..1388011 + 67 NuclAT_43 - Antitoxin
- 1387945..1388011 + 67 NuclAT_43 - Antitoxin
- 1387947..1388010 + 64 NuclAT_46 - -
- 1387947..1388010 + 64 NuclAT_46 - -
- 1387947..1388010 + 64 NuclAT_46 - -
- 1387947..1388010 + 64 NuclAT_46 - -
- 1387947..1388010 + 64 NuclAT_48 - -
- 1387947..1388010 + 64 NuclAT_48 - -
- 1387947..1388010 + 64 NuclAT_48 - -
- 1387947..1388010 + 64 NuclAT_48 - -
CRT46_RS06695 1388325..1388432 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1388485..1388546 + 62 NuclAT_45 - -
- 1388485..1388546 + 62 NuclAT_45 - -
- 1388485..1388546 + 62 NuclAT_45 - -
- 1388485..1388546 + 62 NuclAT_45 - -
- 1388485..1388546 + 62 NuclAT_47 - -
- 1388485..1388546 + 62 NuclAT_47 - -
- 1388485..1388546 + 62 NuclAT_47 - -
- 1388485..1388546 + 62 NuclAT_47 - -
- 1388485..1388547 + 63 NuclAT_22 - -
- 1388485..1388547 + 63 NuclAT_22 - -
- 1388485..1388547 + 63 NuclAT_22 - -
- 1388485..1388547 + 63 NuclAT_22 - -
- 1388485..1388547 + 63 NuclAT_27 - -
- 1388485..1388547 + 63 NuclAT_27 - -
- 1388485..1388547 + 63 NuclAT_27 - -
- 1388485..1388547 + 63 NuclAT_27 - -
- 1388485..1388547 + 63 NuclAT_32 - -
- 1388485..1388547 + 63 NuclAT_32 - -
- 1388485..1388547 + 63 NuclAT_32 - -
- 1388485..1388547 + 63 NuclAT_32 - -
- 1388485..1388547 + 63 NuclAT_37 - -
- 1388485..1388547 + 63 NuclAT_37 - -
- 1388485..1388547 + 63 NuclAT_37 - -
- 1388485..1388547 + 63 NuclAT_37 - -
- 1388485..1388547 + 63 NuclAT_39 - -
- 1388485..1388547 + 63 NuclAT_39 - -
- 1388485..1388547 + 63 NuclAT_39 - -
- 1388485..1388547 + 63 NuclAT_39 - -
- 1388485..1388547 + 63 NuclAT_44 - -
- 1388485..1388547 + 63 NuclAT_44 - -
- 1388485..1388547 + 63 NuclAT_44 - -
- 1388485..1388547 + 63 NuclAT_44 - -
CRT46_RS06700 1388838..1389938 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
CRT46_RS06705 1390208..1390438 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CRT46_RS06710 1390596..1391291 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
CRT46_RS06715 1391335..1391688 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1387126..1387584 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T86067 WP_000176713.1 NZ_CP023820:c1387897-1387790 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T86067 NZ_CP023820:c1387897-1387790 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT86067 NZ_CP023820:1387945-1388011 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References