Detailed information of TA system TA086056

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 75918..76157
• Replicon: plasmid pEcIMT16316
• Accession: NZ_CP023816
• Organism: Escherichia coli strain IMT16316

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: CRI72_RS25545
• Protein ID: WP_023144756.1
• Coordinates: 76023..76157 (+)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	75918..75978 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CRI72_RS25500	71394..72599	+	1206	WP_001089068.1	tetracycline efflux MFS transporter Tet(B)	-
CRI72_RS25505	72712..73305	-	594	WP_000428546.1	tetracyline resistance-associated transcriptional repressor TetC	-
CRI72_RS25510	73438..73809	+	372	WP_035689358.1	helix-turn-helix domain-containing protein	-
CRI72_RS25515	73819..74340	-	522	Protein_88	IS4 family transposase	-
CRI72_RS25520	74347..74535	-	189	Protein_89	IS1 family transposase	-
CRI72_RS25530	74600..75304	+	705	WP_001067858.1	IS6-like element IS26 family transposase	-
CRI72_RS26440	75665..75951	+	287	Protein_91	DUF2726 domain-containing protein	-
-	75918..75978	-	61	NuclAT_2	-	Antitoxin
-	75918..75978	-	61	NuclAT_2	-	Antitoxin
-	75918..75978	-	61	NuclAT_2	-	Antitoxin
-	75918..75978	-	61	NuclAT_2	-	Antitoxin
CRI72_RS25545	76023..76157	+	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
CRI72_RS25550	76454..76708	+	255	WP_000083850.1	replication regulatory protein RepA	-
CRI72_RS25555	76868..77614	-	747	WP_001016257.1	IS21-like element ISEc12 family helper ATPase IstB	-
CRI72_RS25560	77629..79170	-	1542	WP_002431311.1	IS21-like element ISEc12 family transposase	-
CRI72_RS26445	79401..79535	+	135	Protein_96	protein CopA/IncA	-
CRI72_RS25570	79532..79606	+	75	WP_031943482.1	RepA leader peptide Tap	-
CRI72_RS25575	79599..80456	+	858	WP_000130640.1	incFII family plasmid replication initiator RepA	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / tet(A) / blaTEM-1B / mph(A) / sul1 / qacE / aadA5 / dfrA17 / blaCTX-M-15 / aph(6)-Id / aph(3'')-Ib / sul2 / aac(3)-IId	-	1..145883	145883
	-	inside	IScluster/Tn	tet(B) / tet(A) / blaTEM-1B / mph(A)	-	70199..100057	29858

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T86056 WP_023144756.1 NZ_CP023816:76023-76157 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T86056 NZ_CP023816:76023-76157 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT86056 NZ_CP023816:c75978-75918 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin