Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 19821..20061 | Replicon | plasmid pEcIMT16316 |
| Accession | NZ_CP023816 | ||
| Organism | Escherichia coli strain IMT16316 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | CRI72_RS25145 | Protein ID | WP_001312861.1 |
| Coordinates | 19821..19979 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 20023..20061 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CRI72_RS25105 | 14933..15160 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| CRI72_RS25110 | 15248..15925 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| CRI72_RS25115 | 16059..16442 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| CRI72_RS25120 | 16773..17375 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| CRI72_RS25125 | 17672..18493 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| CRI72_RS25130 | 18612..18899 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| CRI72_RS26425 | 18924..19130 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| CRI72_RS26430 | 19043..19378 | - | 336 | WP_013023876.1 | hypothetical protein | - |
| CRI72_RS25145 | 19821..19979 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 20023..20061 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 20023..20061 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 20023..20061 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 20023..20061 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 21501..21603 | - | 103 | NuclAT_0 | - | - |
| - | 21501..21603 | - | 103 | NuclAT_0 | - | - |
| - | 21501..21603 | - | 103 | NuclAT_0 | - | - |
| - | 21501..21603 | - | 103 | NuclAT_0 | - | - |
| CRI72_RS25155 | 21615..22334 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| CRI72_RS25160 | 22331..22765 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| CRI72_RS25165 | 22820..24778 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / tet(A) / blaTEM-1B / mph(A) / sul1 / qacE / aadA5 / dfrA17 / blaCTX-M-15 / aph(6)-Id / aph(3'')-Ib / sul2 / aac(3)-IId | - | 1..145883 | 145883 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T86049 WP_001312861.1 NZ_CP023816:c19979-19821 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T86049 NZ_CP023816:c19979-19821 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGAGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGAGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 39 bp
>AT86049 NZ_CP023816:c20061-20023 [Escherichia coli]
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|