Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 29433..29703 | Replicon | plasmid pFORC64.2 |
| Accession | NZ_CP023733 | ||
| Organism | Escherichia coli strain FORC 064 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | FORC64_RS26355 | Protein ID | WP_001312861.1 |
| Coordinates | 29545..29703 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 29433..29496 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC64_RS26330 | 25144..25671 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| FORC64_RS26335 | 25729..25962 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| FORC64_RS26340 | 26023..28046 | + | 2024 | Protein_37 | ParB/RepB/Spo0J family partition protein | - |
| FORC64_RS26345 | 28115..28549 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| FORC64_RS26350 | 28546..29265 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 29277..29501 | + | 225 | NuclAT_0 | - | - |
| - | 29277..29501 | + | 225 | NuclAT_0 | - | - |
| - | 29277..29501 | + | 225 | NuclAT_0 | - | - |
| - | 29277..29501 | + | 225 | NuclAT_0 | - | - |
| FORC64_RS27340 | 29286..29465 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 29433..29496 | - | 64 | - | - | Antitoxin |
| FORC64_RS26355 | 29545..29703 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| FORC64_RS27460 | 29941..30318 | - | 378 | Protein_42 | hypothetical protein | - |
| FORC64_RS27465 | 30388..30594 | + | 207 | WP_000547974.1 | hypothetical protein | - |
| FORC64_RS26370 | 30618..30914 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| FORC64_RS26375 | 31025..31846 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| FORC64_RS26380 | 32143..32745 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| FORC64_RS26390 | 33068..33451 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| FORC64_RS26395 | 33645..34316 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| FORC64_RS26400 | 34453..34680 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrS1 | - | 1..70107 | 70107 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T85972 WP_001312861.1 NZ_CP023733:29545-29703 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T85972 NZ_CP023733:29545-29703 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT85972 NZ_CP023733:c29496-29433 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|