Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2491251..2491468 | Replicon | chromosome |
Accession | NZ_CP023561 | ||
Organism | Staphylococcus aureus strain TF3198 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | CPC18_RS12890 | Protein ID | WP_001802298.1 |
Coordinates | 2491364..2491468 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2491251..2491306 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CPC18_RS12870 | 2487389..2488054 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
CPC18_RS12875 | 2488206..2488526 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
CPC18_RS12880 | 2488528..2489508 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
CPC18_RS12885 | 2489774..2490864 | + | 1091 | Protein_2389 | transcriptional regulator | - |
- | 2491251..2491306 | + | 56 | - | - | Antitoxin |
CPC18_RS12890 | 2491364..2491468 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
CPC18_RS14640 | 2491629..2492112 | - | 484 | Protein_2391 | recombinase family protein | - |
CPC18_RS12900 | 2492155..2493291 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
CPC18_RS12905 | 2493580..2493672 | + | 93 | WP_001790138.1 | hypothetical protein | - |
CPC18_RS12910 | 2494377..2495234 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
CPC18_RS12915 | 2495302..2496084 | - | 783 | WP_000908177.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T81627 WP_001802298.1 NZ_CP023561:c2491468-2491364 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T81627 NZ_CP023561:c2491468-2491364 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT81627 NZ_CP023561:2491251-2491306 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|