Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2148318..2148500 | Replicon | chromosome |
Accession | NZ_CP023561 | ||
Organism | Staphylococcus aureus strain TF3198 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CPC18_RS10785 | Protein ID | WP_001801861.1 |
Coordinates | 2148318..2148413 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2148441..2148500 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CPC18_RS10735 | 2143978..2144604 | + | 627 | WP_000669046.1 | hypothetical protein | - |
CPC18_RS10740 | 2144645..2144989 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
CPC18_RS10745 | 2145087..2145638 | + | 552 | WP_000414205.1 | hypothetical protein | - |
CPC18_RS10750 | 2145856..2146497 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
CPC18_RS10755 | 2146611..2146796 | - | 186 | WP_000809857.1 | hypothetical protein | - |
CPC18_RS10760 | 2146798..2146974 | - | 177 | WP_000375476.1 | hypothetical protein | - |
CPC18_RS10765 | 2146985..2147368 | - | 384 | WP_000070811.1 | hypothetical protein | - |
CPC18_RS10775 | 2147972..2148115 | - | 144 | WP_001549059.1 | transposase | - |
CPC18_RS10785 | 2148318..2148413 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2148441..2148500 | - | 60 | - | - | Antitoxin |
CPC18_RS10790 | 2148536..2148637 | + | 102 | WP_001791893.1 | hypothetical protein | - |
CPC18_RS10795 | 2148615..2148791 | - | 177 | Protein_2037 | transposase | - |
CPC18_RS10800 | 2148985..2149362 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2141418..2167015 | 25597 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T81618 WP_001801861.1 NZ_CP023561:2148318-2148413 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T81618 NZ_CP023561:2148318-2148413 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT81618 NZ_CP023561:c2148500-2148441 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|