Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 43035..43299 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP023534 | ||
| Organism | Escherichia coli strain FDAARGOS_403 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | CO706_RS00885 | Protein ID | WP_001387489.1 |
| Coordinates | 43035..43187 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 43237..43299 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CO706_RS00860 | 38527..40695 | + | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
| CO706_RS00865 | 40771..41385 | + | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| CO706_RS00870 | 41483..41692 | + | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
| CO706_RS29680 | 41875..42051 | + | 177 | WP_001054898.1 | hypothetical protein | - |
| CO706_RS00875 | 42116..42412 | - | 297 | WP_001275298.1 | hypothetical protein | - |
| CO706_RS00880 | 42712..42963 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| CO706_RS00885 | 43035..43187 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - | 43237..43299 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 43237..43299 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 43237..43299 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 43237..43299 | + | 63 | NuclAT_0 | - | Antitoxin |
| CO706_RS00890 | 43502..44593 | + | 1092 | WP_000426061.1 | hypothetical protein | - |
| CO706_RS00895 | 44900..46108 | + | 1209 | WP_000121263.1 | IncI1-type conjugal transfer protein TrbA | - |
| CO706_RS00900 | 46127..47197 | + | 1071 | WP_000151588.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / blaCTX-M-15 | - | 1..108679 | 108679 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T81546 WP_001387489.1 NZ_CP023534:c43187-43035 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T81546 NZ_CP023534:c43187-43035 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT81546 NZ_CP023534:43237-43299 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|