Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 1906797..1907014 | Replicon | chromosome |
| Accession | NZ_CP023500 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_412 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | CO684_RS10085 | Protein ID | WP_001802298.1 |
| Coordinates | 1906910..1907014 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 1906797..1906852 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CO684_RS10065 | 1903000..1903665 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| CO684_RS10070 | 1903817..1904137 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| CO684_RS10075 | 1904139..1905119 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| CO684_RS10080 | 1905385..1906476 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 1906797..1906852 | + | 56 | - | - | Antitoxin |
| CO684_RS10085 | 1906910..1907014 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| CO684_RS14420 | 1907175..1907658 | - | 484 | Protein_1864 | recombinase family protein | - |
| CO684_RS10095 | 1907701..1908837 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| CO684_RS10100 | 1909126..1909218 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| CO684_RS10105 | 1909923..1910780 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
| CO684_RS10110 | 1910848..1911630 | - | 783 | WP_000908177.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T81407 WP_001802298.1 NZ_CP023500:c1907014-1906910 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T81407 NZ_CP023500:c1907014-1906910 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT81407 NZ_CP023500:1906797-1906852 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|