Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1730942..1731241 | Replicon | chromosome |
| Accession | NZ_CP023500 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_412 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | CO684_RS09050 | Protein ID | WP_011447039.1 |
| Coordinates | 1731065..1731241 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1730942..1730997 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CO684_RS09000 | 1726273..1726533 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| CO684_RS09005 | 1726586..1726936 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| CO684_RS09010 | 1727621..1728070 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| CO684_RS09015 | 1728165..1728500 | - | 336 | Protein_1665 | SH3 domain-containing protein | - |
| CO684_RS09030 | 1729150..1729641 | - | 492 | WP_000919350.1 | staphylokinase | - |
| CO684_RS09035 | 1729832..1730587 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| CO684_RS09040 | 1730599..1730853 | - | 255 | WP_000611512.1 | phage holin | - |
| CO684_RS09045 | 1730905..1731012 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 1730934..1731073 | + | 140 | NuclAT_0 | - | - |
| - | 1730934..1731073 | + | 140 | NuclAT_0 | - | - |
| - | 1730934..1731073 | + | 140 | NuclAT_0 | - | - |
| - | 1730934..1731073 | + | 140 | NuclAT_0 | - | - |
| - | 1730942..1730997 | + | 56 | - | - | Antitoxin |
| CO684_RS09050 | 1731065..1731241 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| CO684_RS09055 | 1731350..1732123 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| CO684_RS09065 | 1732544..1732918 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| CO684_RS09070 | 1732974..1733261 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| CO684_RS09075 | 1733308..1733460 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | map / hlb / scn / chp / sak / sea / hlb / groEL / hld | 1675965..1801462 | 125497 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T81399 WP_011447039.1 NZ_CP023500:c1731241-1731065 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T81399 NZ_CP023500:c1731241-1731065 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT81399 NZ_CP023500:1730942-1730997 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|