Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1569921..1570103 | Replicon | chromosome |
Accession | NZ_CP023500 | ||
Organism | Staphylococcus aureus strain FDAARGOS_412 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CO684_RS14405 | Protein ID | WP_001801861.1 |
Coordinates | 1569921..1570016 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1570044..1570103 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CO684_RS07965 | 1565581..1566207 | + | 627 | WP_000669046.1 | hypothetical protein | - |
CO684_RS07970 | 1566248..1566592 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
CO684_RS07975 | 1566690..1567241 | + | 552 | WP_000414205.1 | hypothetical protein | - |
CO684_RS07980 | 1567459..1568100 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
CO684_RS07985 | 1568214..1568399 | - | 186 | WP_000809857.1 | hypothetical protein | - |
CO684_RS07990 | 1568401..1568577 | - | 177 | WP_000375476.1 | hypothetical protein | - |
CO684_RS07995 | 1568588..1568971 | - | 384 | WP_000070811.1 | hypothetical protein | - |
CO684_RS08005 | 1569575..1569718 | - | 144 | WP_001549059.1 | transposase | - |
CO684_RS14405 | 1569921..1570016 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1570044..1570103 | - | 60 | - | - | Antitoxin |
CO684_RS08010 | 1570139..1570240 | + | 102 | WP_001791893.1 | hypothetical protein | - |
CO684_RS08015 | 1570218..1570394 | - | 177 | Protein_1513 | transposase | - |
CO684_RS08020 | 1570588..1570965 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1532481..1618514 | 86033 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T81396 WP_001801861.1 NZ_CP023500:1569921-1570016 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T81396 NZ_CP023500:1569921-1570016 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT81396 NZ_CP023500:c1570103-1570044 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|