Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrG-SR6/- |
Location | 2222925..2223214 | Replicon | chromosome |
Accession | NZ_CP023409 | ||
Organism | Bacillus subtilis strain 7PJ-16 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | Bateq7PJ16_RS11910 | Protein ID | WP_009967548.1 |
Coordinates | 2222925..2223041 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2223036..2223214 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
Bateq7PJ16_RS11870 | 2218043..2218294 | + | 252 | WP_159376903.1 | phage holin | - |
Bateq7PJ16_RS11875 | 2218449..2219564 | + | 1116 | WP_159376904.1 | response regulator aspartate phosphatase RapK | - |
Bateq7PJ16_RS11880 | 2219561..2219683 | + | 123 | WP_004399440.1 | phosphatase RapK inhibitor PhrK | - |
Bateq7PJ16_RS11885 | 2219738..2220988 | - | 1251 | WP_159376905.1 | UV damage repair protein UvrX | - |
Bateq7PJ16_RS11890 | 2220981..2221313 | - | 333 | WP_069322722.1 | YolD-like family protein | - |
Bateq7PJ16_RS11895 | 2221487..2221822 | + | 336 | WP_159376906.1 | hypothetical protein | - |
Bateq7PJ16_RS11900 | 2221865..2222221 | - | 357 | WP_019712874.1 | hypothetical protein | - |
Bateq7PJ16_RS11905 | 2222227..2222694 | - | 468 | WP_159376907.1 | YolA family protein | - |
Bateq7PJ16_RS11910 | 2222925..2223041 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- | 2223036..2223214 | - | 179 | NuclAT_1 | - | Antitoxin |
- | 2223036..2223214 | - | 179 | NuclAT_1 | - | Antitoxin |
- | 2223036..2223214 | - | 179 | NuclAT_1 | - | Antitoxin |
- | 2223036..2223214 | - | 179 | NuclAT_1 | - | Antitoxin |
Bateq7PJ16_RS11915 | 2223319..2223852 | - | 534 | WP_004399156.1 | GNAT family N-acetyltransferase | - |
Bateq7PJ16_RS11920 | 2223888..2224466 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
Bateq7PJ16_RS11925 | 2224530..2225027 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
Bateq7PJ16_RS11930 | 2225036..2226751 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
Bateq7PJ16_RS11935 | 2226892..2227425 | - | 534 | WP_159376908.1 | SMI1/KNR4 family protein | - |
Bateq7PJ16_RS11940 | 2227510..2227761 | - | 252 | WP_159376909.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2102251..2231315 | 129064 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T81219 WP_009967548.1 NZ_CP023409:2222925-2223041 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
>T81219 NZ_CP023409:2222925-2223041 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 179 bp
>AT81219 NZ_CP023409:c2223214-2223036 [Bacillus subtilis]
AATGATACAAATAATTATTTTTTGCATTTTGATTTGTAGAAATGCATAAAATAAAAAGACCAGGGTGCTACCAACACCCC
AGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCAGATGTATGTGACATAGTAGACCAACCCTTTAGGGTCGCAAT
CTCAAGGGGAGGTCTATTT
AATGATACAAATAATTATTTTTTGCATTTTGATTTGTAGAAATGCATAAAATAAAAAGACCAGGGTGCTACCAACACCCC
AGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCAGATGTATGTGACATAGTAGACCAACCCTTTAGGGTCGCAAT
CTCAAGGGGAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|