Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 31721..31991 | Replicon | plasmid p74 |
Accession | NZ_CP023389 | ||
Organism | Escherichia coli strain 1105 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CNQ47_RS26135 | Protein ID | WP_001312861.1 |
Coordinates | 31833..31991 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 31721..31784 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CNQ47_RS26910 | 27257..27463 | + | 207 | WP_000275858.1 | hypothetical protein | - |
CNQ47_RS26110 | 27489..28028 | + | 540 | WP_000290838.1 | single-stranded DNA-binding protein | - |
CNQ47_RS26115 | 28091..28324 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
CNQ47_RS26120 | 28390..30348 | + | 1959 | WP_096058005.1 | ParB/RepB/Spo0J family partition protein | - |
CNQ47_RS26125 | 30403..30837 | + | 435 | WP_096058006.1 | conjugation system SOS inhibitor PsiB | - |
CNQ47_RS26130 | 30834..31553 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
CNQ47_RS26760 | 31565..31753 | - | 189 | WP_001336239.1 | hypothetical protein | - |
- | 31565..31789 | + | 225 | NuclAT_0 | - | - |
- | 31565..31789 | + | 225 | NuclAT_0 | - | - |
- | 31565..31789 | + | 225 | NuclAT_0 | - | - |
- | 31565..31789 | + | 225 | NuclAT_0 | - | - |
- | 31721..31784 | - | 64 | - | - | Antitoxin |
CNQ47_RS26135 | 31833..31991 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CNQ47_RS26140 | 32304..33875 | - | 1572 | WP_096058007.1 | IS66 family transposase | - |
CNQ47_RS26145 | 33895..34242 | - | 348 | WP_021557532.1 | IS66 family insertion sequence element accessory protein TnpB | - |
CNQ47_RS26150 | 34242..34892 | - | 651 | WP_096058008.1 | IS66-like element accessory protein TnpA | - |
CNQ47_RS26155 | 34965..35153 | + | 189 | WP_096058009.1 | hypothetical protein | - |
CNQ47_RS26170 | 35625..35912 | + | 288 | WP_000107535.1 | hypothetical protein | - |
CNQ47_RS26175 | 36031..36852 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..74094 | 74094 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T81161 WP_001312861.1 NZ_CP023389:31833-31991 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T81161 NZ_CP023389:31833-31991 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT81161 NZ_CP023389:c31784-31721 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|